ProGP284

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP284
Validation Status Uncharacterized
Organism Information
Organism NameMycobacterium tuberculosis
Domain Bacteria
Classification Family: Mycobacteriaceae
Suborder: Corynebacterineae
Order: Actinomycetales
Subclass: Actinobacteridae
Class: Actinobacteria
Division or phylum: "Actinobacteria"
Taxonomic ID (NCBI) 1773
Genome Sequence(s)
GenBank BX842583.1
EMBL BX842583
Organism Additional Information It is the causative agent of human tuberculosis. The pathogenesis is influenced by its lipoglycans and glycolipids (having a wide range of immunomodulatory activities), and a variety of its virulence factors and antigens.
Gene Information
Gene Namepon1 (Rv3682)
NCBI Gene ID 885751
Protein Information
Protein NamePonA2
UniProtKB/SwissProt ID Q7D529
NCBI RefSeq YP_178005.1
EMBL-CDSCAE55630.1
UniProtKB Sequence >tr|Q7D529|Q7D529_MYCTU Penicillin-binding protein 1 OS=Mycobacterium tuberculosis GN=pon1 PE=4 SV=1 MPERLPAAITVLKLAGCCLLASVVATALTFPFAGGLGLMSNRASEVVANGSAQLLEGQVP AVSTMVDAKGNTIAWLYSQRRFEVPSDKIANTMKLAIVSIEDKRFADHSGVDWKGTLTGL AGYASGDLDTRGGSTLEQQYVKNYQLLVTAQTDAEKRAAVETTPARKLREIRMALTLDKT FTKSEILTRYLNLVSFGNNSFGVQDAAQTYFGINASDLNWQQAALLAGMVQSTSTLNPYT NPDGALARRNVVLDTMIENLPGEAEALRAAKAEPLGVLPQPNELPRGCIAAGDRAFFCDY VQEYLSRAGISKEQVATGGYLIRTTLDPEVQAPVKAAIDKYASPNLAGISSVMSVIKPGK DAHKVLAMASNRKYGLDLEAGETMRPQPFSLVGDGAGSIFKIFTTAAALDMGMGINAQLD VPPRFQAKGLGSGGAKGCPKETWCVVNAGNYRGSMNVTDALATSPNTAFAKLISQVGVGR AVDMAIKLGLRSYANPGTARDYNPDSNESLADFVKRQNLGSFTLGPIELNALELSNVAAT LASGGVWCPPNPIDQLIDRNGNEVAVTTETCDQVVPAGLANTLANAMSKDAVGSGTAAGS AGAAGWDLPMSGKTGTTEAHRSAGFVGFTNRYAAANYIYDDSSSPTDLCSGPLRHCGSGD LYGGNEPSRTWFAAMKPIANNFGEVQLPPTDPRYVDGAPGSRVPSVAGLDVDAARQRLKD AGFQVADQTNSVNSSAKYGEVVGTSPSGQTIPGSIVTIQISNGIPPAPPPPPLPEDGGPP PPVGSQVVEIPGLPPITIPLLAPPPPAPPP
Sequence length 810 AA
Subcellular LocationMembrane associated
Function Penicillin-binding protein with transglycosylase and transpeptidase activities.
Glycosylation Status
Glycosylation Type Information currently not available with us.
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionConcanavalin A (ConA) binding
Literature
Year of Identification2009
Year of Identification Month Wise2009.2
Reference1) Gonzalez-Zamorano, M., Mendoza-Hernandez, G., Xolalpa, W., Parada, C., Vallecillo, A.J., Bigi, F. and Espitia, C. (2009) Mycobacterium tuberculosis glycoproteomics based on ConA-lectin affinity capture of mannosylated proteins. J Proteome Res, 8, 721-733. [PubMed: 19196185]
AuthorGonzalez-Zamorano, M., Mendoza-Hernandez, G., Xolalpa, W., Parada, C., Vallecillo, A.J., Bigi, F. and Espitia, C
Research GroupDepartamento de Inmunologia, Instituto de Investigaciones Biomedicas, Universidad Nacional Autonoma de Mexico, Mexico.
Corresponding Author Espitia, C
ContactDepartamento de Inmunologia, Instituto de Investigaciones Biomedicas, Universidad Nacional Autonoma de Mexico, Mexico.