ProGP285

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP285
Validation Status Uncharacterized
Organism Information
Organism NameMycobacterium tuberculosis
Domain Bacteria
Classification Family: Mycobacteriaceae
Suborder: Corynebacterineae
Order: Actinomycetales
Subclass: Actinobacteridae
Class: Actinobacteria
Division or phylum: "Actinobacteria"
Taxonomic ID (NCBI) 1773
Genome Sequence(s)
GenBank BX842580.1
EMBL BX842580 
Organism Additional Information It is the causative agent of human tuberculosis. The pathogenesis is influenced by its lipoglycans and glycolipids (having a wide range of immunomodulatory activities), and a variety of its virulence factors and antigens.
Gene Information
Gene NameppiB (Rv2582)
NCBI Gene ID 887691
Protein Information
Protein NamePpiB
UniProtKB/SwissProt ID Q50639
NCBI RefSeq NP_217098.1
EMBL-CDSCAB01261.1
UniProtKB Sequence >sp|Q50639|PPIB_MYCTU Probable peptidyl-prolyl cis-trans isomerase B OS=Mycobacterium tuberculosis GN=ppiB PE=3 SV=1 MGHLTPVAAPRLACAFVPTNAQRRATAKRKLERQLERRAKQAKRRRILTIVGGSLAAVAV IVAVVVTVVVNKDDHQSTTSATPTDSASTSPPQAATAPPLPPFKPSANLGANCQYPPSPD KAVKPVKLPRTGKVPTDPAQVSVSMVTNQGNIGLMLANNESPCTVNSFVSLAQQGFFKGT TCHRLTTSPMLAVLQCGDPKGDGTGGPGYQFANEYPTDQYSANDPKLNEPVIYPRGTLAM ANAGPNTNSSQFFMVYRDSKLPPQYTVFGTIQADGLTTLDKIAKAGVAGGGEDGKPATEV TITSVLLD
Sequence length 308 AA
Function Probable peptidyl-prolyl cis-trans isomerase B (EC=5.2.1.8). It may be involved in protein folding.
Glycosylation Status
Glycosylation Type Information currently not available with us.
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionConcanavalin A (ConA) binding
Literature
Year of Identification2009
Year of Identification Month Wise2009.2
Reference1) Gonzalez-Zamorano, M., Mendoza-Hernandez, G., Xolalpa, W., Parada, C., Vallecillo, A.J., Bigi, F. and Espitia, C. (2009) Mycobacterium tuberculosis glycoproteomics based on ConA-lectin affinity capture of mannosylated proteins. J Proteome Res, 8, 721-733. [PubMed: 19196185]
AuthorGonzalez-Zamorano, M., Mendoza-Hernandez, G., Xolalpa, W., Parada, C., Vallecillo, A.J., Bigi, F. and Espitia, C
Research GroupDepartamento de Inmunologia, Instituto de Investigaciones Biomedicas, Universidad Nacional Autonoma de Mexico, Mexico.
Corresponding Author Espitia, C
ContactDepartamento de Inmunologia, Instituto de Investigaciones Biomedicas, Universidad Nacional Autonoma de Mexico, Mexico.