ProGP287

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP287
Validation Status Uncharacterized
Organism Information
Organism NameMycobacterium tuberculosis
Domain Bacteria
Classification Family: Mycobacteriaceae
Suborder: Corynebacterineae
Order: Actinomycetales
Subclass: Actinobacteridae
Class: Actinobacteria
Division or phylum: "Actinobacteria"
Taxonomic ID (NCBI) 1773
Genome Sequence(s)
GenBank BX842575.1
EMBL BX842575
Organism Additional Information It is the causative agent of human tuberculosis. The pathogenesis is influenced by its lipoglycans and glycolipids (having a wide range of immunomodulatory activities), and a variety of its virulence factors and antigens.
Gene Information
Gene NamepstS3 (Rv0928)
NCBI Gene ID 885366
Protein Information
Protein NamePstS3
UniProtKB/SwissProt ID P0A5Y2
NCBI RefSeq YP_177768.1
EMBL-CDSCAE55337.1
UniProtKB Sequence >sp|P0A5Y2|PSTS3_MYCTU Phosphate-binding protein pstS 3 OS=Mycobacterium tuberculosis GN=pstS3 PE=1 SV=1 MKLNRFGAAVGVLAAGALVLSACGNDDNVTGGGATTGQASAKVDCGGKKTLKASGSTAQA NAMTRFVNVFEQACPGQTLNYTANGSGAGISEFNGNQTDFGGSDVPLSKDEAAAAQRRCG SPAWNLPVVFGPIAVTYNLNSVSSLNLDGPTLAKIFNGSITQWNNPAIQALNRDFTLPGE RIHVVFRSDESGTTDNFQRYLQAASNGAWGKGAGKSFQGGVGEGARGNDGTSAAAKNTPG SITYNEWSFAQAQHLTMANIVTSAGGDPVAITIDSVGQTIAGATISGVGNDLVLDTDSFY RPKRPGSYPIVLATYEIVCSKYPDSQVGTAVKAFLQSTIGAGQSGLGDNGYIPIPDEFKS RLSTAVNAIA
Sequence length 370 AA
Subcellular LocationCell membrane
Function Phosphate-binding lipoprotein PSTS3 (PBP-3) (PSTS3) (PHOS1); Part of the ABC transporter complex pstSACB involved in phosphate import. It is induced by phosphate starvation.
Glycosylation Status
Glycosylation Type Information currently not available with us.
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionConcanavalin A (ConA) binding
Literature
Year of Identification2009
Year of Identification Month Wise2009.2
Reference1) Gonzalez-Zamorano, M., Mendoza-Hernandez, G., Xolalpa, W., Parada, C., Vallecillo, A.J., Bigi, F. and Espitia, C. (2009) Mycobacterium tuberculosis glycoproteomics based on ConA-lectin affinity capture of mannosylated proteins. J Proteome Res, 8, 721-733. [PubMed: 19196185]
AuthorGonzalez-Zamorano, M., Mendoza-Hernandez, G., Xolalpa, W., Parada, C., Vallecillo, A.J., Bigi, F. and Espitia, C
Research GroupDepartamento de Inmunologia, Instituto de Investigaciones Biomedicas, Universidad Nacional Autonoma de Mexico, Mexico.
Corresponding Author Espitia, C
ContactDepartamento de Inmunologia, Instituto de Investigaciones Biomedicas, Universidad Nacional Autonoma de Mexico, Mexico.