ProGP290

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP290
Validation Status Uncharacterized
Organism Information
Organism NameMycobacterium tuberculosis
Domain Bacteria
Classification Family: Mycobacteriaceae
Suborder: Corynebacterineae
Order: Actinomycetales
Subclass: Actinobacteridae
Class: Actinobacteria
Division or phylum: "Actinobacteria"
Taxonomic ID (NCBI) 1773
Genome Sequence(s)
GenBank BX842574.1
EMBL BX842574
Organism Additional Information It is the causative agent of human tuberculosis. The pathogenesis is influenced by its lipoglycans and glycolipids (having a wide range of immunomodulatory activities), and a variety of its virulence factors and antigens.
Gene Information
Gene NameRv0907
NCBI Gene ID 885146
Protein Information
Protein NameRv0907
UniProtKB/SwissProt ID O05900
NCBI RefSeq NP_215422.1
EMBL-CDSCAB08514.1
UniProtKB Sequence >tr|O05900|O05900_MYCTU Putative uncharacterized protein OS=Mycobacterium tuberculosis GN=Rv0907 PE=4 SV=2 MATICGHDQTSGNGRHGDVADVNGCGSTHQALGPPSGLPDASPNERSAIQIPAGRIDDAV AKVDGLVGELMQNTGIPGMAVAIVHGGKTLYAKGFGVRDVGKGGGPDNKVDADTVFQLAS VSKSVGATVVAHAVTDNVVTWDTPVVSKLPWFALRDPYVTGQVTIADLYSHRSGLPDHAG DLLEDLGYDRRQVLQRLKYLPLAPFRISYAYTNFGVTAAAEAVAAAAGQSWEDLSDEVLY RPLGMGSTSSRFTDFLARPNHAVNHVKVADRWEARYQRDPDAQSPAGGVSSSLNDMTHWL AMVLADGVYNGRRITSPEALLPVYTPQVISRHPVSPRARASFYGYGFNVGVTSSGRTEYS HSGAFGLGAAANFVVLPSEDLAIIALTNAGPIGVPETLTAEFMDLVQYGQVREDWAALYK KAFAPLNELAGSLVGKQSPANPAPSRPLNDYVGVYANDYWGPATVTYHDGQLRLSLGPKN QTFDLTHWDGDTFTFTLSTENALPGSISKATFAGDTLNLEYYDADKLGTFTR
Sequence length 532 AA
Glycosylation Status
Technique(s) used for Glycosylation DetectionConcanavalin A (ConA) binding
Literature
Year of Identification2009
Year of Identification Month Wise2009.2
ReferenceGonzalez-Zamorano, M., Mendoza-Hernandez, G., Xolalpa, W., Parada, C., Vallecillo, A.J., Bigi, F. and Espitia, C. (2009) Mycobacterium tuberculosis glycoproteomics based on ConA-lectin affinity capture of mannosylated proteins. J Proteome Res, 8, 721-733. [PubMed: 19196185]
AuthorGonzalez-Zamorano, M., Mendoza-Hernandez, G., Xolalpa, W., Parada, C., Vallecillo, A.J., Bigi, F. and Espitia, C
Research GroupDepartment of Immunology, Institute of Biomedical Research, National Autonomous University of Mexico, Mexico.
Corresponding Author Espitia, C
ContactDepartment of Immunology, Institute of Biomedical Research, National Autonomous University of Mexico, Mexico.