ProGP297

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP297
Validation Status Uncharacterized
Organism Information
Organism NameAeromonas caviae Sch3N strain
Domain Bacteria
Classification Family: Aeromonadaceae
Order: Aeromonadales
Class: Gammaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI) 648
Genome Sequence(s)
GenBank AF198617 
EMBL AF198617 
Gene Information
Gene NameflaB
Protein Information
Protein NameFlaB (Flagellin)
UniProtKB/SwissProt ID Q9R9R8
UniProtKB Sequence >tr|Q9R9R8|Q9R9R8_AERCA Flagellin OS=Aeromonas caviae GN=flaB PE=3 SV=1 MAMYINTNTSSLNAQRNLMNTSKSMDTSYTRLASGLRINSAKDDAAGLQISNRLTSQING LDQGNRNANDGISLAQTAEGAMDEVTGMLQRMRTLAQQSANGSNSDKDRAALQKEVNQLG AEINRISKDTTFAGTKLLDGNYSGKFQVGADANQTIGFSLSQAGGFSISGIAKAAGTTID IVSGPAGSVTTATGISLIFVSGSAGGISISTQSKAQAVLAAADAMLEVVDGKRAELGAVQ NRLDSTIRNQANISENVSAARSRIRDANFATETANMTKHNILQQAASSILAQANQRPQSA LQLLG
Function Polar flagellin
Glycosylation Status
Glycosylation Type O- (Ser/Thr) linked
Glycan Information
Glycan Annotation Six to eight Pse5Ac7Ac (pseudaminic acid) residues found in S/T-rich domain spanning residues 146 to 232.
Literature
Year of Identification2009
Year of Identification Month Wise2009.2.13
ReferenceTabei SM, Hitchen PG, Day-Williams MJ, Merino S, Vart R, Pang PC, Horsburgh GJ, Viches S, Wilhelms M, Tomás JM, Dell A, Shaw JG. (2009) An Aeromonas caviae genomic island is required for both O-antigen lipopolysaccharide biosynthesis and flagellin glycosylation. J Bacteriol., 191(8):2851-63.
AuthorTabei SM, Hitchen PG, Day-Williams MJ, Merino S, Vart R, Pang PC, Horsburgh GJ, Viches S, Wilhelms M, Tomás JM, Dell A, Shaw JG
Research GroupUnit of Infection and Immunity, School of Medicine and Biomedical Sciences, University of Sheffield, Sheffield S10 2RX, United Kingdom. 
Corresponding Author Shaw JG
ContactUnit of Infection and Immunity, School of Medicine and Biomedical Sciences, University of Sheffield, Sheffield S10 2RX, United Kingdom.