ProGP299

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP299
Validation Status Characterized
Organism Information
Organism NameNeisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Domain Bacteria
Classification Family: Neisseriaceae
Order: Neisseriales
Class: Betaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI) 242231
Genome Sequence(s)
GenBank AE004969.1
EMBL AE004969
Organism Additional Information Neisseria gonorrhoeae is the etiologic agent of the human disease gonorrhoea. It is equipped with a variety of adherence factors that help it in the colonization of diverse microenvironments in the human host. The property of phase and antigenic variation displayed by its type IV pilin enables it to avoid immune system thereby initiating the disease.
Gene Information
Gene NameNGO1371
NCBI Gene ID 3282544
GenBank Gene Sequence 3282544
Protein Information
Protein NameCcoP
UniProtKB/SwissProt ID Q5F718
NCBI RefSeq YP_208431.1
EMBL-CDSAAW90019.1
UniProtKB Sequence >tr|Q5F718|Q5F718_NEIG1 Putative cytochrome c oxidase subunit OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=NGO1371 PE=4 SV=1 MNATSQFTSNFWNIYIAVIVLLSFIALAWLLLSQNVVKRPKKGEEVQTTGHEWDGIAEYD NPLPRWWFWLCVLTWLFGIGYLVMYPGVGDYKGLLKWTSHNQYEKEVKKADEQYGKLYAK FADMPIEKVAKDPQAKQIAQNLFNTYCIQCHGSDAKGSKGFPNLTDSDWLWGGDPDKIHE TIEKGRVATMPAWGPALGEEGVKDVAHYVMSLSKPKGQYDEERAARGQALFSGPPANCFT CHGDKGQGIQGLGPNLTDDVWLWGGTQKSIIETITNGRSSQMPAWGHFLDKDKLHIMTAY VWGLSNKDGKAPVKKAEPAPAAEPAPSAPAEAAQAASEAKPAAAEPKAEEKAAPAAKADG KQVYETVCAACHGNAIPGIPHVGTKADWADRIKKGKDTLHKHAIEGFNTMPAKGGRGDLS DDEVKAAVDYMVNQSGGKF
Sequence length 439 AA
Subcellular LocationPeriplasm
Function Cytochrome cbb3 oxidase subunit. EC=1.9.3.1.
Glycosylation Status
Glycosylation Type O- (Ser) linked
Experimentally Validated Glycosite(s) in Full Length ProteinS337
Experimentally Validated Glycosite(s ) in Mature ProteinS337
Glycosite(s) Annotated Protein Sequence >tr|Q5F718|Q5F718_NEIG1 Putative cytochrome c oxidase subunit OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=NGO1371 PE=4 SV=1 MNATSQFTSNFWNIYIAVIVLLSFIALAWLLLSQNVVKRPKKGEEVQTTGHEWDGIAEYD NPLPRWWFWLCVLTWLFGIGYLVMYPGVGDYKGLLKWTSHNQYEKEVKKADEQYGKLYAK FADMPIEKVAKDPQAKQIAQNLFNTYCIQCHGSDAKGSKGFPNLTDSDWLWGGDPDKIHE TIEKGRVATMPAWGPALGEEGVKDVAHYVMSLSKPKGQYDEERAARGQALFSGPPANCFT CHGDKGQGIQGLGPNLTDDVWLWGGTQKSIIETITNGRSSQMPAWGHFLDKDKLHIMTAY VWGLSNKDGKAPVKKAEPAPAAEPAPSAPAEAAQAAS*(337)EAKPAAAEPKAEEKAAPAAKADG KQVYETVCAACHGNAIPGIPHVGTKADWADRIKKGKDTLHKHAIEGFNTMPAKGGRGDLS DDEVKAAVDYMVNQSGGKF
Sequence Around Glycosites (21 AA) SAPAEAAQAASEAKPAAAEPK
Technique(s) used for Glycosylation DetectionImmunoblotting with antiglycan antibodies
Technique(s) used for Glycosylated Residue(s) Detection Substitution mutation analysis
Glycan Information
Glycan Annotation O-AcHexDATDH (433 Da). DATDH is 2,4 diacetamido-2,4,6 trideoxyhexose.
Technique(s) used for Glycan Identification LC-ESI-MS/MS with CID (liquid chromatography-electrospray ionization–tandem mass spectrometry with collision-induced dissociation)
Protein Glycosylation linked (PGL) gene(s)
OST Gene NamePglO
OST ProGT IDProGT19
Additional CommentSequone feature: S/T plus low complexity region.
Literature
Year of Identification2009
Year of Identification Month Wise2009.3.17
Year of Validation 2009
ReferenceVik, A., Aas, F.E., Anonsen, J.H., Bilsborough, S., Schneider, A., Egge-Jacobsen, W. and Koomey, M. (2009) Broad spectrum O-linked protein glycosylation in the human pathogen Neisseria gonorrhoeae. Proc Natl Acad Sci U S A, 106, 4447-4452. [PubMed: 19251655]
AuthorVik, A., Aas, F.E., Anonsen, J.H., Bilsborough, S., Schneider, A., Egge-Jacobsen, W. and Koomey, M.
Research GroupDepartment of Molecular Biosciences and Center for Molecular Biology and Neuroscience, University of Oslo, Oslo 0316, Norway.
Corresponding Author Koomey, M.
ContactDepartment of Molecular Biosciences and Center for Molecular Biology and Neuroscience, University of Oslo, Oslo 0316, Norway.