ProGP303

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP303
Validation Status Uncharacterized
Organism Information
Organism NameNeisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Domain Bacteria
Classification Family: Neisseriaceae
Order: Neisseriales
Class: Betaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI) 242231
Genome Sequence(s)
GenBank AE004969.1
EMBL AE004969
Organism Additional Information Neisseria gonorrhoeae is the etiologic agent of the human disease gonorrhoea. It is equipped with a variety of adherence factors that help it in the colonization of diverse microenvironments in the human host. The property of phase and antigenic variation displayed by its type IV pilin enables it to avoid immune system thereby initiating the disease.
Gene Information
Gene NameNGO1717
NCBI Gene ID 3281356
Protein Information
Protein NameDsbA ;EC=5.3.4.1
UniProtKB/SwissProt ID Q5F649
NCBI RefSeq YP_208750.1
EMBL-CDSAAW90338.1
UniProtKB Sequence >tr|Q5F649|Q5F649_NEIG1 Putative thiol:disulphide interchange protein OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=NGO1717 PE=4 SV=1 MKSRHLALALGVAALFALAACDSKVQTSVPADSAPAASAAAAPAGLVEGQNYTVLANPIP QQQAGKVEVLEFFGYFCPHCARLEPVLSKHAKSFKDDMYLRTEHVVWQKEMLPLARLAAA VDMAAAESKDVANSHIFDAMVNQKIKLQEPEVLKKWLGEQTAFDGKKVLAAYESPESQAR AGKMQELTETFQIDGTPTVIVGGKYKVEFADWESGMNTIDLLADKVREEQKAAQ
Sequence length 234 AA
Subcellular LocationPeriplasm
Function Thiol-disulfide isomerase.
Glycosylation Status
Technique(s) used for Glycosylation DetectionImmunoblotting using anti glycan antibodies
Literature
Year of Identification2009
Year of Identification Month Wise2009.3
ReferenceVik, A., Aas, F.E., Anonsen, J.H., Bilsborough, S., Schneider, A., Egge-Jacobsen, W. and Koomey, M. (2009) Broad spectrum O-linked protein glycosylation in the human pathogen Neisseria gonorrhoeae. Proc Natl Acad Sci U S A, 106, 4447-4452. [PubMed: 19251655]
Author Vik, A., Aas, F.E., Anonsen, J.H., Bilsborough, S., Schneider, A., Egge-Jacobsen, W. Koomey, M.
Research GroupDepartment of Molecular Biosciences and Center for Molecular Biology and Neuroscience, University of Oslo, Oslo 0316, Norway.
Corresponding Author Koomey, M.
ContactDepartment of Molecular Biosciences and Center for Molecular Biology and Neuroscience, University of Oslo, Oslo 0316, Norway.