ProGP309

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP309
Validation Status Uncharacterized
Organism Information
Organism NameStreptomyces coelicolor J1929
Domain Bacteria
Classification Family: Streptomycetaceae
Suborder: Streptomycineae
Order: Actinomycetales
Subclass: Actinobacteridae
Class: Actinobacteria
Division or phylum: "Actinobacteria"
Taxonomic ID (NCBI) 1902
Genome Sequence(s)
GenBank AL939119.1
EMBL AL939119
Gene Information
Gene NamepstS (SCO4142)
NCBI Gene ID 1099582
Protein Information
Protein NamePstS (40 kDa)
UniProtKB/SwissProt ID Q9KZV9
NCBI RefSeq NP_628319.1
EMBL-CDSCAB88475.1
UniProtKB Sequence >tr|Q9KZV9|Q9KZV9_STRCO Phosphate-binding protein OS=Streptomyces coelicolor GN=SCO4142 PE=4 SV=1 MNRRALALGALAVSGALALTACGSDDTGGNSGSDSSSAAANSNIKCDDAKGQLQASGSSA QKNAIDAWVKQYVAACNGVQINYNPTGSGAGITAFTQGQTAFAGSDSALKPDEIEASKKV CKDGQAIDLPMVGGPIAVGFNVTGVDSLVLDAPTMAKIFDSKITNWNDEAIKKLNPDAKL PDLKIQAFHRSDESGTTDNFTKYLKAAAPDDWKYEGGKSWEAKGGQSAQGSSGLAGQVKQ TPGAISYFELSYAKDGIKTVDVKTAAAEPVKATVENATAAIGAAKVVGTGKDLALELDYT PDAAGAYPLVLVTYEIACDKGNKADTLPATKSFLNYMASEDGQGLLADAGYAPMPTEIIT KVRETISGLS
Sequence length 370 AA
Subcellular LocationSecreted
Function Phosphate binding protein involved in high affinity phosphate uptake.
Glycosylation Status
Technique(s) used for Glycosylation DetectionPro-Q Emerald Glycoprotein staining (that uses periodate oxidation) and ConA–sepharose affinity chromatography.
Glycan Information
Glycan Annotation Trihexose (mannose).
Protein Glycosylation linked (PGL) gene(s)
OST ProGT IDProGT38
Accessory Gene(s)Progt IDProGT38.1
Additional CommentBoth Pmt (putative protein O-mannosyltransferase) and Ppm1 (polyprenol phosphate mannose synthase) are required for glycosylation. Ppm1 transfers mannose to endogenous polyprenol phosphate in membrane preparations. Ppm1 catalyzes mannose transfer.
Literature
Year of Identification2009
Year of Identification Month Wise2009.3
ReferenceWehmeier, S., Varghese, A.S., Gurcha, S.S., Tissot, B., Panico, M., Hitchen, P., Morris, H.R., Besra, G.S., Dell, A. and Smith, M.C. (2009) Glycosylation of the phosphate binding protein, PstS, in Streptomyces coelicolor by a pathway that resembles protein O-mannosylation in eukaryotes. Mol Microbiol, 71, 421-433. [PubMed: 19017269]
Author Wehmeier, S., Varghese, A.S., Gurcha, S.S., Tissot, B., Panico, M., Hitchen, P., Morris, H.R., Besra, G.S., Dell, A. Smith, M.C.
Research GroupSchool of Medical Sciences, Institute of Medical Sciences, University of Aberdeen, Aberdeen AB25 2ZD, UK
Corresponding Author Smith, M.C.
ContactSchool of Medical Sciences, Institute of Medical Sciences, University of Aberdeen, Aberdeen AB25 2ZD, UK