ProGP316 (Srr1)

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP316 (Srr1)
Validation Status Uncharacterized
Organism Information
Organism NameStreptococcus agalactiae
Domain Bacteria
Classification Family: Streptococcaceae
Order: Lactobacillales
Class: Bacilli (or Firmibacteria)
Division or phylum: "Firmicutes"
Taxonomic ID (NCBI) 211110
Genome Information
GenBank NC_004368.1
EMBL AL766851
Protein Information
Protein NameSrr1
UniProtKB/SwissProt ID Q8E473
EMBL-CDSCAD47188.1
UniProtKB Sequence >tr|Q8E473|Q8E473_STRA3 Uncharacterized protein OS=Streptococcus agalactiae serotype III (strain NEM316) GN=gbs1529 PE=1 SV=1 MSQKTFGKQLTVVDTKSRVKMHKSGKNWVRTVMSHFNLFKAIKGRATVEADVCIQDVEKE DRLSSGNLTYLKGILAAGALVGGASLTSRVYADETPVVQEQSSSVPTLAEQTEVTVKTTT VQNHQDGTVSKNIIDSNSVSMSESASTSTSESVSMSMSGSTLTSVSESVSTSALTSASES ISTSASESVSKSTSISEVSNILETQASLTDKGRESFSANQIVTESSLVTDAGKNASVSSL IEITKPKSELQTSKMSNESLITPEKSQVMIASDKTGNESLTPTIRLKSVIQPRSMNLMTL SSEMDLIPLEEVSDTEMLGKDVSSELQKVNIALKDNTLSEPGTVKLDSSENLVLNFAFSI ASVNEGDVFTVKLSDNLDTQGIGTILKVQDIMDETGQLLATGSYSPLTHNITYTWTRYAS TLNNIKARVNMPVWPDQRIISKTTSDKQCFTATLNNQVASIEERVQYNSPSVTEHTNVKT NVRSRIMKLDDERQTETYITQINPEGKEMYFASGLGNLYTIIGSDGTSGSPVNLLNAEVK ILKTNSKNLTDSMDQNYDSPEFEDVTSQYSYTNDGSKITIDWKTNSISSTTSYVVLVKIP KQSGVLYSTVSDINQTYGSKYSYGHTNISGDSDANAEIKLLSESASTSASTSASTSASMS ASTSASTSASMSASTSASTSASMSASTSASTSASTSTSTSASTSASTSASTSASMSASTS ASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASMS ASMSASTSASMSASTSASTSASTSASTSASTSASTSASMSASTSASTSASTSASMSASTS ASTSASTSASTSASTSTSTSASTSASTSASTSASMSASTSASTSPSTSASTSASTSASTS ASTSASTSASMSASTSASTSASMSASTSASTSASTSASTSASMSASTSASTSASTSASMS ASTSASTSASTSASTSASTSTSTSASTSASTSASTSASMSASTSASTSASTSASMSASTS ASISASTSASMSASTSASTSASTSASTSASMSASTSASTSASTSASTSASMSASTSASTS ASTSASTSASTSASTSASTSASTSSSTSASTSASTSASTSASMSASTSASTSASMSASTS ASTSASTSASMSASTSSSTSASMSASTSASMSASTSASTSASTSASMSASTSSSTSASMS ASTSASMSASTSASTSASTSASMSASTSASMSATTSASTSVSTSASTSASTSASTSSSSS VTSNSSKEKVYSALPSTGDQDYSVTATALGLGLMTGATLLGRKKSKKDKD
Sequence length 1310 AA
Subcellular LocationSurface
Glycosylation Status
Glycosylation Type O- (Ser/Thr) linked
Technique(s) used for Glycosylation DetectionLectin binding WITH Swga, Western blot analysis
Glycan Information
Glycan Annotation GlcNAc with hexose sugar
Protein Glycosylation linked (PGL) gene(s)
OST ProGT ID
Literature
ReferenceMistou MY, Dramsi S, Brega S, Poyart C, Trieu-Cuot P. (2009) Molecular dissection of the secA2 locus of g B Streptococcus reveals that glycosylation of the Srr1 LPXTG protein is required for full virulence. J Bacteriol., 191(13):4195-206. [PubMed: 19395494 ]
AuthorMistou MY, Dramsi S, Brega S, Poyart C, Trieu-Cuot P.
Research GroupInstitut Pasteur, Biological Unit of Gram-Positive Pathogenic Bacteria, URA CNRS 2172, Paris Cedex 15, France.
Corresponding Author Trieu-Cuot P
ContactInstitut Pasteur, Biological Unit of Gram-Positive Pathogenic Bacteria, URA CNRS 2172, Paris Cedex 15, France.
ReferenceChaze T, Guillot A, Valot B, Langella O, Chamot-Rooke J, Di Guilmi AM, Trieu-Cuot P, Dramsi S, Mistou MY.(2014) O-Glycosylation of the N-terminal region of the serine-rich adhesin Srr1 of Streptococcus agalactiae explored by mass spectrometry. Mass,Mol Cell Proteomics, 13(9), 2168-82. [PubMed: 24797265]
AuthorChaze T, Guillot A, Valot B, Langella O, Chamot-Rooke J, Di Guilmi AM, Trieu-Cuot P, Dramsi S, Mistou MY.
Research Group1 INRA, MICALIS UMR-1319, 78352 Jouy-en-Josas cedex, France; AgroParisTech, MICALIS UMR-1319, 78352 Jouy-en-Josas cedex, France; Institute of Pasteur, Structural and Proteomic Mass Spectrometry Unit, 28 rue du Dr Roux, 75015 Paris, France 2 INRA, PAPPSO, MICALIS UMR-1319, 78352 Jouy en Josas cedex, France 3 INRA, PAPPSO, Plant genetics UMR-320, Ferme du Moulon, 91190 Gif sur Yvette, France; 4 Institut Pasteur, Structural and Proteomic Mass Spectrometry Unit, 28 rue du Dr Roux, 75015 Paris, France; CNRS UMR 3528, Institut Pasteur, 28 rue du Dr Roux, 75015 Paris, France. 5 CEA,Institute of Structural Biology Jean-Pierre Ebel, F-38027 Grenoble, France 6 Institut Pasteur, Unit of Biology of Pathogenic Bacteria in Gram +, 28, rue du Dr Roux, 75015 Paris, France; National Center for Scientific Research, CNRS ERL3526, Paris, France; 7 INRA, MICALIS UMR-1319, 78352 Jouy-en-Josas cedex, France
ContactINRA, MICALIS UMR-1319, 78352 Jouy-en-Josas cedex, France