ProGP316

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP316
Validation Status Uncharacterized
Organism Information
Organism NameStreptococcus agalactiae
Domain Bacteria
Classification Family: Streptococcaceae
Order: Lactobacillales
Class: Bacilli (or Firmibacteria)
Division or phylum: "Firmicutes"
Taxonomic ID (NCBI) 211110
Genome Sequence(s)
GenBank NC_004368.1
EMBL AL766851
Protein Information
Protein NameSrr1
UniProtKB/SwissProt ID Q8E473
EMBL-CDSCAD47188.1
UniProtKB Sequence >tr|Q8E473|Q8E473_STRA3 Uncharacterized protein OS=Streptococcus agalactiae serotype III (strain NEM316) GN=gbs1529 PE=1 SV=1 MSQKTFGKQLTVVDTKSRVKMHKSGKNWVRTVMSHFNLFKAIKGRATVEADVCIQDVEKE DRLSSGNLTYLKGILAAGALVGGASLTSRVYADETPVVQEQSSSVPTLAEQTEVTVKTTT VQNHQDGTVSKNIIDSNSVSMSESASTSTSESVSMSMSGSTLTSVSESVSTSALTSASES ISTSASESVSKSTSISEVSNILETQASLTDKGRESFSANQIVTESSLVTDAGKNASVSSL IEITKPKSELQTSKMSNESLITPEKSQVMIASDKTGNESLTPTIRLKSVIQPRSMNLMTL SSEMDLIPLEEVSDTEMLGKDVSSELQKVNIALKDNTLSEPGTVKLDSSENLVLNFAFSI ASVNEGDVFTVKLSDNLDTQGIGTILKVQDIMDETGQLLATGSYSPLTHNITYTWTRYAS TLNNIKARVNMPVWPDQRIISKTTSDKQCFTATLNNQVASIEERVQYNSPSVTEHTNVKT NVRSRIMKLDDERQTETYITQINPEGKEMYFASGLGNLYTIIGSDGTSGSPVNLLNAEVK ILKTNSKNLTDSMDQNYDSPEFEDVTSQYSYTNDGSKITIDWKTNSISSTTSYVVLVKIP KQSGVLYSTVSDINQTYGSKYSYGHTNISGDSDANAEIKLLSESASTSASTSASTSASMS ASTSASTSASMSASTSASTSASMSASTSASTSASTSTSTSASTSASTSASTSASMSASTS ASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASMS ASMSASTSASMSASTSASTSASTSASTSASTSASTSASMSASTSASTSASTSASMSASTS ASTSASTSASTSASTSTSTSASTSASTSASTSASMSASTSASTSPSTSASTSASTSASTS ASTSASTSASMSASTSASTSASMSASTSASTSASTSASTSASMSASTSASTSASTSASMS ASTSASTSASTSASTSASTSTSTSASTSASTSASTSASMSASTSASTSASTSASMSASTS ASISASTSASMSASTSASTSASTSASTSASMSASTSASTSASTSASTSASMSASTSASTS ASTSASTSASTSASTSASTSASTSSSTSASTSASTSASTSASMSASTSASTSASMSASTS ASTSASTSASMSASTSSSTSASMSASTSASMSASTSASTSASTSASMSASTSSSTSASMS ASTSASMSASTSASTSASTSASMSASTSASMSATTSASTSVSTSASTSASTSASTSSSSS VTSNSSKEKVYSALPSTGDQDYSVTATALGLGLMTGATLLGRKKSKKDKD
Sequence length 1310 AA
Subcellular LocationSurface
Glycosylation Status
Glycosylation Type O- (Ser/Thr) linked
Technique(s) used for Glycosylation DetectionLectin binding WITH Swga, Western blot analysis
Glycan Information
Glycan Annotation GlcNAc with hexose sugar
Protein Glycosylation linked (PGL) gene(s)
OST ProGT IDProGT30-ProGT37
Characterized Accessory Gene(s)gtfA and gtfB complex transfer GlcNAc ,with gtf(C-H) transfer hexose to GlcNac modified Srr1
Literature
Year of Identification2009
Year of Identification Month Wise2009.4.24
ReferenceMistou MY, Dramsi S, Brega S, Poyart C, Trieu-Cuot P. (2009) Molecular dissection of the secA2 locus of g B Streptococcus reveals that glycosylation of the Srr1 LPXTG protein is required for full virulence. J Bacteriol. 2009 Jul;191(13):4195-206. doi:
AuthorMistou MY, Dramsi S, Brega S, Poyart C, Trieu-Cuot P.
Research GroupInstitut Pasteur, Biological Unit of Gram-Positive Pathogenic Bacteria, URA CNRS 2172, Paris Cedex 15, France.
Corresponding Author Trieu-Cuot P
ContactInstitut Pasteur, Biological Unit of Gram-Positive Pathogenic Bacteria, URA CNRS 2172, Paris Cedex 15, France.
ReferenceChaze T, Guillot A, Valot B, Langella O, Chamot-Rooke J, Di Guilmi AM, Trieu-Cuot P, Dramsi S, Mistou MY.(2014). O-Glycosylation of the N -terminal Region of the Serine-rich Adhesin Srr1 of Streptococcus agalactiae Explored by Mass, (10), 2168-2182. https://doi.org
AuthorChaze T1, Guillot A2, Valot B3, Langella O3, Chamot-Rooke J4, Di Guilmi AM5, Trieu-Cuot P6, Dramsi S6, Mistou MY7.
Research Group1 INRA, MICALIS UMR-1319, 78352 Jouy-en-Josas cedex, France; AgroParisTech, MICALIS UMR-1319, 78352 Jouy-en-Josas cedex, France; Institut Pasteur, Structural and Proteomic Mass Spectrometry Unit, 28 rue du Dr Roux, 75015 Paris, France 2 INRA, PAPPSO, MICALIS UMR-1319, 78352 Jouy en Josas cedex, France 3 INRA, PAPPSO, Plant genetics UMR-320, Ferme du Moulon, 91190 Gif sur Yvette, France; 4 Institut Pasteur, Structural and Proteomic Mass Spectrometry Unit, 28 rue du Dr Roux, 75015 Paris, France; CNRS UMR 3528, Institut Pasteur, 28 rue du Dr Roux, 75015 Paris, France. 5 CEA,Institute of Structural Biology Jean-Pierre Ebel, F-38027 Grenoble, France; 6 Institut Pasteur, Unit of Biology of Pathogenic Bacteria in Gram +, 28, rue du Dr Roux, 75015 Paris, France; National Center for Scientific Research, CNRS ERL3526, Paris, France; 7 INRA, MICALIS UMR-1319, 78352 Jouy-en-Josas cedex, France
ContactINRA, MICALIS UMR-1319, 78352 Jouy-en-Josas cedex, France