ProGP317

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP317
Validation Status Uncharacterized
Organism Information
Organism NameBacteroides fragilis
Domain Bacteria
Classification Family: Bacteroidaceae
Order: "Bacteroidales"
Class: "Bacteroidia"
Division or phylum: "Bacteroidetes"
Taxonomic ID (NCBI) 272559
Genome Sequence(s)
GenBank CR626927.1
EMBL CR626927
Organism Additional Information The Bacteroides constitute the major population of human intestinal microbiota. They are beneficial to the humans in terms of metabolism, development, and immunity. They play roles in recycling of bile acids, provision of short-chain fatty acids to the host and angiogenesis.
Gene Information
Gene NameBF3567
NCBI Gene ID 3286131
Protein Information
Protein NameBF3567
UniProtKB/SwissProt ID Q5L9H5
NCBI RefSeq YP_213166.1
EMBL-CDSCAH09252.1
UniProtKB Sequence >tr|Q5L9H5|Q5L9H5_BACFN Putative uncharacterized protein OS=Bacteroides fragilis (strain ATCC 25285 / NCTC 9343) GN=BF3567 PE=4 SV=1 MKKNLLYLSCALMCMLGFLSSCKDDEKEIPPVVEDVVAQYTGDKVKVTLGGEAVSGDAQI DLVQQDDKSLTIKLLNIIPDVKEFSIPNAEFEATTRSAYISKLSGKVSNAVVGYDVTFEG VVDEGVLTASITATEIKGDSINAKKAGLTGKTFKGKMTINVSNIPTPIEMEQRVYTSVVS KDTSAIKLKINDFAFQGLKLGDISLDTVAVRHRGEQDGKPIYGFKTKSQEMTLEAVGKVL IDANGTIIGEKMELSLNVNAVTAGLTVGVDFSGNIVEESTDTKATITVTGDAVAEGVTVS GNTYTFKVWESTPDDQLVFIPKIEIPATAVLDSIIIYDNRNKKVSAVEPNTAIDFSQLKE NYYVGYHVTPEDIRYPSKKMLKMVRIAELNPVYDMATWVADGDFEKPNGLTTSNLAAAFF PMFGIDVPTPVVKASDNAAEITTSRTVSATLPSTLVPGVTAGTMFLGEFKVDITNTLKST HFGVPYRVKPVNFKITYKYTPGTTFYKTVVKNNANDTEVVPNEKDECSINAYLYEVDSYA ETLDGTNINTSNKVIMKAVLEDGSAKADYVTLTIPFKETGNGSFDPTKKKYKLAIVCSSS KKGDQFMGADGSKLWVKYLEVTR
Sequence length 623 AA
Subcellular LocationOuter membrane - facing surface
Glycosylation Status
Glycosylation Type Information currently not available with us.
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionMass shift detected on SDS-polyacrylamide gel, AAL (Aleuria aurantia lectin) reactivity, Pro-Q Emerald Glycostaining and reactivity towards anti-glycan antiserum
Glycan Information
Glycan Annotation Exogenous fucose.
Literature
Year of Identification2009
Year of Identification Month Wise2009.4
Reference1) Fletcher, C.M., Coyne, M.J., Villa, O.F., Chatzidaki-Livanis, M. and Comstock, L.E. (2009) A general O-glycosylation system important to the physiology of a major human intestinal symbiont. Cell, 137, 321-331. [PubMed: 19379697]
Author Comstock, L.E.
Research GroupChanning Laboratory, Brigham and Women's Hospital, Harvard Medical School, 181 Longwood Avenue, Boston, MA 02115, USA.
Corresponding Author Fletcher, C.M., Coyne, M.J., Bentley, D.L., Villa, O.F. Comstock, L.E.
ContactChanning Laboratory, Brigham and Women's Hospital, Harvard Medical School, 181 Longwood Avenue, Boston, MA 02115, USA.