ProGP320

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP320
Validation Status Uncharacterized
Organism Information
Organism NameMycobacterium tuberculosis
Domain Bacteria
Classification Family: Mycobacteriaceae
Suborder: Corynebacterineae
Order: Actinomycetales
Subclass: Actinobacteridae
Class: Actinobacteria
Division or phylum: "Actinobacteria"
Taxonomic ID (NCBI) 1773
Genome Sequence(s)
GenBank BX842578.1
EMBL BX842578
Organism Additional Information It is the causative agent of human tuberculosis. The pathogenesis is influenced by its lipoglycans and glycolipids (having a wide range of immunomodulatory activities), and a variety of its virulence factors and antigens.
Gene Information
Gene NamelppC (Rv1911c)
NCBI Gene ID 885646
Protein Information
Protein NameLppC
UniProtKB/SwissProt ID P9WFN3
NCBI RefSeq WP_003409568.1
EMBL-CDSCCP44678.1
UniProtKB Sequence >sp|P9WFN3|LPPC_MYCTU Putative lipoprotein LppC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=lppC PE=1 SV=2 MTSTLHRTPLATAGLALVVALGGCGGGGGDSRETPPYVPKATTVDATTPAPAAEPLTIAS PMFADGAPIPVQFSCKGANVAPPLTWSSPAGAAELALVVDDPDAVGGLYVHWIVTGIAPG SGSTADGQTPAGGHSVPNSGGRQGYFGPCPPAGTGTHHYRFTLYHLPVALQLPPGATGVQ AAQAIAQAASGQARLVGTFEG
Sequence length 205 AA
Function Lipoprotein
Glycosylation Status
Technique(s) used for Glycosylation DetectionConcanavalin A (ConA) binding
Literature
Year of Identification2009
Year of Identification Month Wise2000.5
ReferenceGonzalez-Zamorano, M., Mendoza-Hernandez, G., Xolalpa, W., Parada, C., Vallecillo, A.J., Bigi, F. and Espitia, C. (2009) Mycobacterium tuberculosis glycoproteomics based on ConA-lectin affinity capture of mannosylated proteins. J Proteome Res, 8, 721-733. [PubMed: 19196185]
AuthorGonzalez-Zamorano, M., Mendoza-Hernandez, G., Xolalpa, W., Parada, C., Vallecillo, A.J., Bigi, F. and Espitia, C
Research GroupDepartment of Immunology, Institute of Biomedical Research, National Autonomous University of Mexico, Mexico.
Corresponding Author Espitia, C
ContactDepartment of Immunology, Institute of Biomedical Research, National Autonomous University of Mexico, Mexico.