ProGP322

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP322
Validation Status Uncharacterized
Organism Information
Organism NameEscherichia coli (ETEC) strain H10407
Domain Bacteria
Classification Family: Enterobacteriaceae
Order: "Enterobacteriales"
Class: Gammaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI) 316401
Genome Sequence(s)
GenBank FN649418
EMBL FN649418
Organism Additional Information Escherichia coli (Gram-negative) is the predominant facultative organism in the human intestine. It is responsible for a number of diseases like urinary tract infections, gastroenteritis (diarrhoea), meningitis, traveler's diarrhea andhemorrhagic colitis. There are a myriad of serotypes of pathogenic E. coli. Adhesion to the host cells is an important step in its pathogenesis. However, most strains are harmless and normal flora residing in the gut.
Gene Information
Gene NameetpA (ETEC_p948_0110)
Protein Information
Protein NameEtpA Adhesin
UniProtKB/SwissProt ID E3PP99
EMBL-CDSCBJ04458.1
UniProtKB Sequence >tr|E3PP99|E3PP99_ECOH1 Two-partner secreted adhesin EtpA OS=Escherichia coli O78:H11 (strain H10407 / ETEC) GN=etpA PE=4 SV=1 MNRIYKLKFDKRRNELVVVSEITTGVGNAKATGSVEGEKSPRRGVRAMALSLLSGMMIMA HPAMSANLPTGGQIVAGSGSIQTPSGNQMNIHQNSQNMVANWNSFDIGKGNTVQFDQPSS SAVALNRVVGGGESQIMGNLKANGQVFLVNPNGVLFGEGASVSTSGFVASTRDIKNDDFM NRRYTFSGGQKAGAAIVNQGELTTNAGGYIVLAADRVSNSGTIRTPGGKTVLAASERITL QLDNGGLMSVQVTGDVVNALVENRGLVSARDGQVYLTALGRGMLMNTVLNVSGVVEASGM HRQDGNIVLDGGDSGVVHLSGTLQADNASGQGGKVVVQGKNILLDKGSNITATGGQGGGE VYVGGGWQGKDSNIRNADKVVMQGGARIDVSATQQGNGGTAVLWSDSYTNFHGQISAKGG ETGGNGGRVETSSHGNLQAFGTVSASAKKGKAGNWLLDSADITIVNGSNVSKTETTQSPP HTQFAPTAAGSAVSNTSINNRLNNGTSVTILTHRTRTGTAQGGNITVNAAINKSNGSDVN LTLQAGGNITVNNSITSTEGKLNVNLSGARTSNGSITISNNANITTNGGDITVGTTNTSN RVNISINNTTLNASNGNIQLTGTGTDSGILFAGNNRLTASNIALTGNSTSGNAINLTGTA TLNATNNITLTGSSTSGNAINLKGNNTLTASNITLTGESTSGNAINLTDTTGTTTLNATN NITMQGTRVQIKHSNITAGNFALNATVAGSEISNTTLTATNNINLAAKTNSASSGVYLKD ARITSTNGSITANGTATANGKATHLDGNVTLNASNGRIKLTGNGHGSASGILFAGNNRLT ASNIALTGNSTSGNAINLTGTATLNATNDITLTGSSTSGNAINLTGTATLNATNNITLTG SSTSGNAINLKGNNTLTASNITLTGESTSGNAINLTDTTGTTTLNATNNITMQGTRVQIK HSNITAGNFALNATVAGSEISNTTLTATNNINLAAKTNSASSGVYLKDARITSTNGSITA NGTATANGKATHLDGNVTLNASNGRIKLTGNGHGSASGILFAGNNRLTASNIALTGNSTS GNAINLTGTATLNATNDITLTGSSTSGNAINLTGTATLNATNNITLTGSSTSGNAINLKG NNTLTASNITLTGESTSGNAINLTDTTGTTTLNATNNITMQGTRVQIKHSNITAGNFALN ATVAGSEISNTTLTATNNINLAAKTNSASSGVYLKDARITSTNGSITANGTATANGKATH LDGNVTLNASNGRIKLTGNGHGSASGILFAGNNRLTASNIALTGNSTSGNAINLTGTATL NATNDITLTGSSTSGNAINLTGTATLNATNNITLTGSSTSGNAINLKGNNTLTASNITLT GESTSGNAINLTDTTGTTTLNATNNITMQGTRVQIKHSNITAGNFALNATVAGSEISNTT LTATNNINLAAKTNSASSGVYLKDARITSTNGSITANGTAPANDNATYLDGNVTLNASNG SIKLTGNGNGSTSGILFAGNNTLTASNITLTGNSEVYWQ
Sequence length 1539 AA
Subcellular LocationSecreted
Function EtpA adhesin has a role in bridging flagella and host cells. Colonization by ETEC H10407 is prevented by immunizing mice with recombinant, full length EtpA glycoprotein.
Glycosylation Status
Glycosylation Type Information currently not available with us.
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionDIG (digoxigenin) Glycan detection
Glycan Information
Glycan Annotation 6-deoxy-Tal-Thr.
Literature
Year of Identification2009
Year of Identification Month Wise2009.7
Reference1) Roy, K., Hamilton, D., Ostmann, M.M. and Fleckenstein, J.M. (2009) Vaccination with EtpA glycoprotein or flagellin protects against colonization with enterotoxigenic Escherichia coli in a murine model. Vaccine, 27, 4601-4608. [PubMed: 19523914]
Author Roy, K., Hamilton, D., Ostmann, M.M. Fleckenstein, J.M.
Research GroupVeterans Affairs Medical Center, Departments of Medicine, University of Tennessee Health Science Center, Memphis, TN, USA.
Corresponding Author Fleckenstein, J.M.
ContactVeterans Affairs Medical Center, Departments of Medicine, University of Tennessee Health Science Center, Memphis, TN, USA.