ProGP324

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP324
Validation Status Characterized
Organism Information
Organism NameClostridium difficile 06Cd-130
Domain Bacteria
Classification Family: Clostridiaceae
Order: Clostridiales
Class: Clostridia
Division or phylum: "Firmicutes"
Taxonomic ID (NCBI) 1496
Genome Sequence(s)
EMBL GU048823
Organism Additional Information Clostridium difficile is a gram-positive, anaerobic, spore-forming bacterium that produces TcdA and TcdB toxins causing severe tissue damage. It ia an opportunistic pathogen that is the major cause of antibiotic-associated diarrhoea and pseudomembranous colitis in humans. C. dificile infection can also result in abdominal pain, inflammation, and ulceration of the lining of the intestinal wall.
Gene Information
Gene NamefliC
Protein Information
Protein NameFliC (Flagellin)
UniProtKB/SwissProt ID D0V7J6
EMBL-CDSACY01337.1
UniProtKB Sequence >tr|D0V7J6|D0V7J6_CLODI Flagellin OS=Clostridium difficile GN=fliC PE=4 SV=1 MRVNTNVSALIANNQMGRNVNAQSKSMEKLSSGVRIKRAADDAAGLAISEKMRAQIKGLD QAGRNVQDGISVVQTAEGALEETGNILQRMRTLSVQSSNETNTAEERQKIADELLQLKDE VERISSSIEFNGKKLLDGSSTEIRLQVGANFGTNVAGTSNNNNEIKVALVNTSSIMSKAG ITSSTIASLNADGTSGTNAAKQMVSSLDVALKELNTSRAKLGAQQNRLESTQNNLNNTIE NVTAAESRIRDTDVASEMVNLSKMNILVQASQSMLAQANQQPQGVLQLLG
Sequence length 290 AA
Subcellular LocationSurface
Function Forms the filaments of bacterial flagella.
Glycosylation Status
Glycosylation Type O (Ser/Thr) linked
Experimentally Validated Glycosite(s) in Full Length ProteinT141, S174, S205
Experimentally Validated Glycosite(s ) in Mature ProteinT141, S174, S205
Glycosite(s) Annotated Protein Sequence >tr|D0V7J6|D0V7J6_CLODI Flagellin OS=Clostridium difficile GN=fliC PE=4 SV=1 MRVNTNVSALIANNQMGRNVNAQSKSMEKLSSGVRIKRAADDAAGLAISEKMRAQIKGLD QAGRNVQDGISVVQTAEGALEETGNILQRMRTLSVQSSNETNTAEERQKIADELLQLKDE VERISSSIEFNGKKLLDGSST*(141)EIRLQVGANFGTNVAGTSNNNNEIKVALVNTSS*(174) IMSKAG ITSSTIASLNADGTSGTNAAKQMVS*(205)SLDVALKELNTSRAKLGAQQNRLESTQNNLNNTIE NVTAAESRIRDTDVASEMVNLSKMNILVQASQSMLAQANQQPQGVLQLLG
Sequence Around Glycosites (21 AA) NGKKLLDGSSTEIRLQVGANF
EIKVALVNTSSIMSKAGITSS
SGTNAAKQMVSSLDVALKELN
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionIntact mass analysis with QTOF2-MS (hybrid quadrupole time of flight mass spectrometry)
Technique(s) used for Glycosylated Residue(s) Detection Electron transfer dissociation (ETD) MS
Glycan Information
Glycan Annotation Several novel glycan moieties, ranging in mass from 494 Da to 917 Da. HexNAc and methylated deoxyhexose found.
Technique(s) used for Glycan Identification MS/MS (tandem mass spectrometry), nESI-feCID-MS/MS (nano-electrospray ionization–front-end collision-induced dissociation MS/MS) analyses
Protein Glycosylation linked (PGL) gene(s)
OST ProGT IDProGT29,ProGT113,ProGT114,ProGT115,ProGT116,ProGT117
Literature
Year of Identification2009
Year of Identification Month Wise2009.11.1
Year of Validation 2009
Reference1) Twine, S.M., Reid, C.W., Aubry, A., McMullin, D.R., Fulton, K.M., Austin, J. and Logan, S.M. (2009) Motility and flagellar glycosylation in Clostridium difficile. J Bacteriol, 191, 7050-7062. [PubMed: 19749038]
Author Twine, S.M., Paul, C.J., Vinogradov, E., McNally, D.J., Brisson, J.R., Mullen, J.A., McMullin, D.R., Jarrell, H.C., Austin, J.W., Kelly, J.F. et al.
Research GroupNRC-Institute for Biological Sciences, Ottawa, Canada.
Corresponding Author Kelly, J.F
ContactNRC-Institute for Biological Sciences, Ottawa, Canada.