ProGP33

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP33
Validation Status Uncharacterized
Organism Information
Organism NameStreptococcus pyogenes strain Su
Domain Bacteria
Classification Family: Streptococcaceae
Order: Lactobacillales
Class: Bacilli (or Firmibacteria)
Division or phylum: "Firmicutes"
Taxonomic ID (NCBI) 1314
Genome Sequence(s)
EMBL X55659
Gene Information
Gene NamearcA or sagP
Protein Information
Protein NameStreptococcal acid glycoprotein SAGP
UniProtKB/SwissProt ID P0C0B3
EMBL-CDSCAA39192.1
UniProtKB Sequence >sp|P0C0B3|ARCA_STRPY Arginine deiminase OS=Streptococcus pyogenes GN=arcA PE=1 SV=2 MTAQTPIHVYSEIGKLKKVLLHRPGKEIENLMPDYLERLLFDDIPFLEDAQKEHDAFAQA LRDEGIEVLYLETLAAESLVTPEIREAFIDEYLSEANIRGRATKKAIRELLMAIEDNQEL IEKTMAGVQKSELPEIPASEKGLTDLVESNYPFAIDPMPNLYFTRDPFATIGTGVSLNHM FSETRNRETLYGKYIFTHHPIYGGGKVPMVYDRNETTRIEGGDELVLSKDVLAVGISQRT DAASIEKLLVNIFKQNLGFKKVLAFEFANNRKFMHLDTVFTMVDYDKFTIHPEIEGDLRV YSVTYDNEELHIVEEKGDLAELLAANLGVEKVDLIRCGGDNLVAAGREQWNDGSNTLTIA PGVVVVYNRNTITNAILESKGLKLIKIHGSELVRGRGGPRCMSMPFEREDI
Sequence length 411 AA
Subcellular LocationIntracellular
Function Antitumour protein.
Literature
Year of Identification1985
Year of Identification Month Wise1985.1
ReferenceDegnan, B.A., Palmer, J.M., Robson, T., Jones, C.E., Fischer, M., Glanville, M., Mellor, G.D., Diamond, A.G., Kehoe, M.A. and Goodacre, J.A. (1998) Inhibition of human peripheral blood mononuclear cell proliferation by Streptococcus pyogenes cell extract is associated with arginine deiminase activity. Infect Immun, 66, 3050-3058. [PubMed: 9632565]
AuthorDegnan, B.A., Palmer, J.M., Robson, T., Jones, C.E., Fischer, M., Glanville, M., Mellor, G.D., Diamond, A.G., Kehoe, M.A. Goodacre, J.A.
Research GroupSchool of Clinical Medical Sciences (Rheumatology), Immunological and Virological Sciences, The Medical School, University of Newcastle upon Tyne, Newcastle upon Tyne, NE2 4HH, United Kingdom
Corresponding Author Goodacre, J.A.
ContactSchool of Clinical Medical Sciences (Rheumatology), Immunological and Virological Sciences, The Medical School, University of Newcastle upon Tyne, Newcastle upon Tyne, NE2 4HH, United Kingdom
Reference1) Degnan, B.A., Fontaine, M.C., Doebereiner, A.H., Lee, J.J., Mastroeni, P., Dougan, G., Goodacre, J.A. and Kehoe, M.A. (2000) Characterization of an isogenic mutant of Streptococcus pyogenes Manfredo lacking the ability to make streptococcal acid glycoprotein. Infect Immun, 68, 2441-2448. [PubMed: 10768929]
AuthorDegnan BA1, Fontaine MC, Doebereiner AH, Lee JJ, Mastroeni P, Dougan G, Goodacre JA, Kehoe MA.
Research GroupSchool of Clinical Medical Sciences (Rheumatology), Medical School, University of Newcastle, Newcastle upon Tyne NE2 4HH, United Kingdom.
Corresponding Author Kehoe MA.
ContactSchool of Clinical Medical Sciences (Rheumatology), Medical School, University of Newcastle, Newcastle upon Tyne NE2 4HH, United Kingdom.
Reference4 Kanaoka, M., Fukita, Y., Taya, K., Kawanaka, C., Negoro, T. and Agui, H. (1987) Antitumor activity of streptococcal acid glycoprotein produced by Streptococcus pyogenes Su. Jpn J Cancer Res, 78, 1409-1414. [PubMed: 3123442]
AuthorKanaoka, M., Fukita, Y., Taya, K., Kawanaka, C., Negoro, T. and Agui, H
Research GroupBiotechnology Laboratory, Takarazuka Research Center, Sumitomo Chemical Co. Ltd., Hyogo.
Corresponding Author Agui, H
ContactBiotechnology Laboratory, Takarazuka Research Center, Sumitomo Chemical Co. Ltd., Hyogo.
ReferenceKanaoka, M., Negoro, T., Kawanaka, C., Agui, H. and Nabeshima, S. (1991) Streptococcal antitumor protein: expression in Escherichia coli cells and properties of the recombinant protein. Agric Biol Chem, 55, 743-750.
AuthorKanaoka, M., Negoro, T., Kawanaka, C., Agui, H. Nabeshima, S.
Research GroupTakarazuka Research Center, Sumitomo Chemical Co., Ltd., Hyogo, Japan.
Corresponding Author Nabeshima, S.
ContactTakarazuka Research Center, Sumitomo Chemical Co., Ltd., Hyogo, Japan.