ProGP331

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP331
Validation Status Uncharacterized
Organism Information
Organism NameHaloferax volcanii DS2
Domain Archaea
Classification Family: Halobacteriaceae
Order: Halobacteriales
Class: Halobacteria or Halomebacteria
Division or phylum: "Euryarchaeota"
Taxonomic ID (NCBI) 309800
Genome Sequence(s)
GenBank CP001953.1
EMBL CP001953
Gene Information
Gene NamelccA
NCBI Gene ID 8919198
Protein Information
Protein NameLccA, an Archaeal Laccase
UniProtKB/SwissProt ID D4GPK6
NCBI RefSeq YP_003533285.1
EMBL-CDSADE01515.1
UniProtKB Sequence >tr|D4GPK6|D4GPK6_HALVD LccA multicopper oxidase (MCO) OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / IFO 14742 / NCIMB 2012 / DS2) GN=lccA PE=4 SV=1 MTDWSRRRFLQTGAALGIAGTLPQTTTEVSAASPTLEKFVQPLPIPSVREPDGQRDGADA YEIAVTEFTQQLHPDLPETTVWGFDGSYPGPTIEADAGSPVHVRFDNSGLPSEHLFPVDD RLGGTTAENHPGYDGPVPEVRTVTHFHGLELDPANDGQSDMWTSPGGVEGPRFDSAWQEL PMEQGRTTSTYHDHTLGITRLNAYAGLLGLYSITTDAERELGLPSGDYDIPLLLQDKEFN DDGSLHYPEEFVSAFLGDTAVVNGAVWPYVEVEPRRYRFRILNGANHRSFDLQLESESGS GVPTMYQFAPGHGFLESVVPIGPNGDLDSLLLTPFERGELVVDFSDHAGETLTLANGADM GPELTDLVEFRVSDPSTPPEDASADPTSLSLPTPASYDESDARVTREMTLGTEVRNGLIT HTLNGHVFGDEDAPVYPQLGATEIWELQNESGGRHPIHLHLVTFRVIGRGPDGTQPPDPN ELGPKDTVRVDPGERVRILVTFEGYTGQFPWHCHMLEHEDNKMMIPFVVENPVADYANEE NVVDATGLTDAVGDWRNETLETEVLLEVIDQWRSGDEVA
Sequence length 579 AA
Subcellular LocationSecreted
Function Belongs to the family of Multicopper oxidases (MCOs). Laccases couple the oxidation of phenolic compounds to the reduction of O2.
Glycosylation Status
Glycosylation Type Information currently not available with us.
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionCarbohydrate content determined by phenol-sulfuric acid assay, Pro-Q Emerald 300 staining and mass shift (of 10-20 kDa) detected after deglycosylation with TFMS (trifluoromethanesulfonic acid).
Literature
Year of Identification2010
Year of Identification Month Wise2010.2
Reference1) Uthandi, S., Saad, B., Humbard, M.A. and Maupin-Furlow, J.A. (2010) LccA, an archaeal laccase secreted as a highly stable glycoprotein into the extracellular medium by Haloferax volcanii. Appl Environ Microbiol, 76, 733-743. [PubMed: 19966030]
Author Uth i, S., Saad, B., Humbard, M.A.
Research GroupDepartment of Microbiology and Cell Science, University of Florida, Gainesville, FL 32611-0700, USA.
Corresponding Author i, S., Saad, B., Humbard, M.A.
ContactDepartment of Microbiology and Cell Science, University of Florida, Gainesville, FL 32611-0700, USA.