ProGP332

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP332
Validation Status Uncharacterized
Organism Information
Organism NameAggregatibacter actinomycetemcomitans
Domain Bacteria
Classification Family: Pasteurellaceae
Order: Pasteurellales
Class: Gammaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI) 714 
Genome Sequence(s)
GenBank NZ_CP016553.1. 
EMBL AB011405 
Gene Information
Gene NameemaA
GenBank Gene Sequence AY344064.1
Protein Information
Protein NameExtracellular matrix protein adhesin A (EmaA)
UniProtKB/SwissProt ID Q6VBQ2
NCBI RefSeq AAQ22366.1
EMBL-CDSAAQ22366.1
UniProtKB Sequence >tr|Q6VBQ2|Q6VBQ2_AGGAC EmaA OS=Aggregatibacter actinomycetemcomitans GN=emaA PE=4 SV=1 MNKVFKVIWCKTSQTWIAVSELSKAFSLSTTTDIPKKTKIFIAAAPLLFLSFNTNAYIAI GSVENNSVKSEGAEASPNKRKGSQALNYYNPGSKSYDDKDKPSNPERRYSNGEAYGIAIG KNTDVRDSSKDSNGIALGDYSKATGGLAMALGSFSRAEKNGGIAIGIASRSSGINSLAMM RQSAATGDYSTAIGSVAWAAGQSSFALGASATAKGNQSIAIGSLEQKISPNGSGVPITKY NGLDNTQTNGNRSMALGTAAKTNGDDSFAIGYKAHTGEFKVEHDNYLKENVTSPDLSKKA DKAIAVGTSALAQKESAIAFGYQANASGINAISLGANAKASQDNVVAIGKDATATESGSM AIGQGAKSTFKNSLALGTGTIVNSVDGGQSKFTAQNYDANNGVVAVANAGKERRIINVAG GRNDTDAVNVAQLKFVNDNLAKSIAGAGYNGYETDGHTYKAPVFSIKNTNYHDVKTAVEA AQTNYVSVNSTNTAADSNYDNKGAKAVGSIALGEKATTGRAAMNSIAIGLNSNVSGQNTV ALGANITATTNGSVILGNSSTTEGSHPVSNVSSATVNGYTYSGFTGTVKESGHFVSIGSK GNERQIKNVAAGNVAANSTDAVNGSQLFAVASRVEQGWQITSGVENGGTQNGAASTATIK PSNQVKLLAGKNLAVKQNGTNFTFSTQENVTFTNVTTQDLTATGNTTVKNFSVQNGGTIN MGNNRITGVAEGTQDDDAVNFKQLKSLLGGSASTEIVEKKAAQAGDENLADISVANGKNA GDMGAKYEVSVSKKAVQSAAKEAVKVTGSAPINVNKTDVNGVDTYAVTFNGTEAAKSIPL TYKANGSGDKTVMLDKGLNFTNGMMTTASVANDGVMKYDVNLSTIKVEDGKAAVAGTPGT NGANGTDGKDGVATVKNVVEALNNAAWTITASKSDGEVVSNASNSVKNGDTVTYDAGKNI KITQRDKKFSFATKDNVEFTSVTTGNTKLTGNGVEITNGPKLTQSGVDAGGKKITNVADG VIAANSKDAVNGGQLFAETAKAKTTVEKGDDNIQITSETATDGHINYKVALNPSLTVGPR TNGHPITIDGNNGYITGLTNTSWTGAPTTGRAATEDQLSIVDKKFDNKVSLGGDNGSTTE KSLSHNGGIKFNIKGGDSQKYVTTSGSGDDVTVDLAQTTKNKIDNAADKDLANITDNGKK VITALGAVVKAADSTITVTDETDNTTGQKTYKIKANIPTPEKTAMAPGNNTTIEGDGSAA NPFKVNLKDDLALGQKDANGVTGKDSSIKVNGKDGSGVAINGKDGSIALNGKDGANPVTI KTAQGPAGVNETNPKDRLMVNNDAVATLKDGLKFAGDNSTEVITKTLNQKLEIVGGADKN KLSDNNIGVNANNGKLEVKLAKELNELTSAQFKNGDNTTVINGNGITITPKDPTKAVSLT DKGLNNGGNQIVNIDSGLKQADGSTVALKDASGDTLKNAANIGDLQKSINDITDASKNGG FGLSDDNGATAKANLGETVKVKGDGSVITKVVTDNGKPTLQVGLSNDITVGDDAQAGTIS VKGENGKDGVSINGKEASVTFAKDGQPGMSIAATRSADGKDALTLKGKDGKDGISFQEDG RITQVADGVNDKDAVNKSQLDRSIAQAKSGVSAGKNITVTPQKNADGSTTYTVETQKDVE FSTVKTGDTTLDSNGVNINGGPSVTKDGIHANDKKITGVKDGEISAHSKEAVNGSQLHQT NQNVTNLANNVDKGLNFQGDNQEVTVNRKLGDQLNIRGGADPKKLTQNNIGVTADKNGTM TVQLAKEVNLGADGSLTVGNTTVNNDGVTIKDGPSMTSHGINAGGKRIANVAKGKAPTDA VNMSQLQDVGSAINNRIDNIDKRVKKMDKRRKAGTASALATAGLMQPHRDGQSALVAAVG QYQSETAVAVGYSRISDNGKYGVKVSFSTNSQGEVGGTAGAGYFW
Sequence length 1965 AA
Subcellular LocationOuter membrane
Function EmaA monomers trimerize to form antennae-like structures on the surface of the bacterium required for collagen binding.
Glycosylation Status
Technique(s) used for Glycosylation DetectionLectin binding.
Glycan Information
Glycan Annotation Protein is associated with carbohydrate, and the carbohydrate is composed of sugars associated with the serotype b O-PS. The A. actinomycetemcomitans serotype b O-PS is a trisaccharide-repeating unit composed of D-Fuc, L-Rha, and D-GalNAc residues.Rha and Fuc were the main sugars identified in the analysis of the LPS isolated from the serotype b.
Literature
Year of Identification2010
Year of Identification Month Wise2010.3
ReferenceTang, G. and Mintz, K.P. (2010) Glycosylation of the collagen adhesin EmaA of Aggregatibacter actinomycetemcomitans is dependent upon the lipopolysaccharide biosynthetic pathway. J Bacteriol, 192, 1395-1404. [PubMed: 20061477]
Author Tang, G. Mintz, K.P.
Research GroupDepartment of Microbiology and Molecular Genetics, Room 118, Stafford Hall, University of Vermont, Burlington, VT 05405, USA
Corresponding Author Mintz, K.P.
ContactDepartment of Microbiology and Molecular Genetics, Room 118, Stafford Hall, University of Vermont, Burlington, VT 05405, USA