ProGP335

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP335
Validation Status Uncharacterized
Organism Information
Organism NameFrancisella tularensis ssp. holarctica strain FSC200
Domain Bacteria
Classification Family: Francisellaceae
Order:Thiotrichales
Class: Gammaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI) 351581
Genome Sequence(s)
GenBank CP003862.1
EMBL CP003862.1
Gene Information
Gene NameFTH_1855
GenBank Gene Sequence NC_008369.1
Protein Information
Protein NameFTH_1855
UniProtKB/SwissProt ID A0A0B3VWE4
NCBI RefSeq WP_010030827.1
EMBL-CDSAJI52138.1
UniProtKB Sequence >tr|A0A0B3VWE4|A0A0B3VWE4_FRATU Periplasmic solute binding family protein OS=Francisella tularensis subsp. holarctica GN=DA46_783 PE=4 SV=1 MKKYILIALAAVVIVALVAINLLAESDKPQTTKGSHDISVVAAENQYGSIAKLIGGSNVK VTNIIDNADGDPHTFVSSVKNAKLLAEADVIIYNGADYDSWITPILKTNKNAEIIKVQDL INYPQTEKLGINPHLWYDPDTFPALAAKLKDVFSKQDSVDNSLFEKNLENFNHKYQKVYD LVKQIKQSSSGTPVTATEPLFGYMANALGLDMKGLAFQWVIMNDSEPSPKMMINYQKLFN DKQVKVLFYNKQVTDNVTSDVLEVAKKNNIPVVGITETMPVNYDAINWMIETLQATAVAL DKVQK
Sequence length 305 AA
Subcellular LocationMembrane
Function ABC transporter substrate-binding protein
Glycosylation Status
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionLectin labeling and lectin affinity chromatography
Literature
Year of Identification2010
Year of Identification Month Wise2010.4.5
ReferenceBalonova L, Hernychova L, Mann BF, Link M, Bilkova Z, Novotny MV, Stulik J. (2010) Multimethodological approach to identification of glycoproteins from the proteome of Francisella tularensis, an intracellular microorganism. J Proteome Res., 9, 1995-2005. [PMID: 20175567
AuthorBalonova L1, Hernychova L, Mann BF, Link M, Bilkova Z, Novotny MV, Stulik J.
Research GroupInstitute of Molecular Pathology, Faculty of Military Health Sciences, University of Defence, Hradec Kralove, Czech Republic
Corresponding Author Stulik J.
ContactInstitute of Molecular Pathology, Faculty of Military Health Sciences, University of Defence, Hradec Kralove, Czech Republic