ProGP337

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP337
Validation Status Uncharacterized
Organism Information
Organism NameFrancisella tularensis ssp. holarctica strain FSC200
Domain Bacteria
Classification Family: Francisellaceae
Order:Thiotrichales
Class: Gammaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI) 351581
Genome Sequence(s)
GenBank CP003862.1
EMBL CP003862.1
Gene Information
Gene NameFTH_1112
GenBank Gene Sequence NC_008369.1
Protein Information
Protein NameFTH_1112
UniProtKB/SwissProt ID A0A0B3WI34
NCBI RefSeq WP_003016117.1
EMBL-CDSAJI50820.1
UniProtKB Sequence >tr|A0A0B3WI34|A0A0B3WI34_FRATU 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Francisella tularensis subsp. holarctica GN=fabF PE=3 SV=1 MKSNRRVVVTGLGMVTPLGNDVPTTWANILAGKSGVETITGFDTPAPDISEFKVRFAARI KNFDVDALVGKKDAKRVDPFCYYGIAAANEALKDAGIDKVSEEDSYKFGVCVSSGIGGIE TLETTKAVIDTKGPSKISPFCIPSSIVNMLSGIISINHGLRGPNIPIVTACTTGTHNIGM AARLIASGDADAMLAGGSEKASNAIGMGGFAAARALSTRNDDPQGASRPWDKDRDGFVLG DGAGVVVLEEYERAKARGAKIYAEVVGFGMSADGYHMTMPYAPGQERCIQNALADAGLEN NPDAIDYVNAHGTSTPLGDVQESQVVEKVIGQYRKDLVMSSTKSMTGHLLGAAGAIESIF SVLAIRDQVAPPTINLHNLDDGCNLDYAANAAKKMKIDYVLNNSFGFGGTNGSVIFKKI
Sequence length 419 AA
Subcellular LocationMembrane
Function beta-ketoacyl-[acyl-carrier-protein] synthase II
Glycosylation Status
Glycosylation Type O- (Ser/Thr) linked
Technique(s) used for Glycosylation DetectionLectin labeling and lectin affinity chromatography
Literature
Year of Identification2010
Year of Identification Month Wise2010.4.5
ReferenceBalonova L, Hernychova L, Mann BF, Link M, Bilkova Z, Novotny MV, Stulik J. (2010) Multimethodological approach to identification of glycoproteins from the proteome of Francisella tularensis, an intracellular microorganism. J Proteome Res., 9, 1995-2005. [PMID: 20175567
AuthorBalonova L, Hernychova L, Mann BF, Link M, Bilkova Z, Novotny MV, Stulik J.
Research GroupInstitute of Molecular Pathology, Faculty of Military Health Sciences, University of Defence, Hradec Kralove, Czech Republic
Corresponding Author Stulik J.
ContactInstitute of Molecular Pathology, Faculty of Military Health Sciences, University of Defence, Hradec Kralove, Czech Republic