ProGP341

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP341
Validation Status Uncharacterized
Organism Information
Organism NameFrancisella tularensis ssp. holarctica strain FSC200
Domain Bacteria
Classification Family: Francisellaceae
Order:Thiotrichales
Class: Gammaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI) 351581
Genome Sequence(s)
GenBank CP003862.1
EMBL CP003862.1
Gene Information
Gene NameFTH_1721
GenBank Gene Sequence NC_008369.1
Protein Information
Protein NameFTH_1721
UniProtKB/SwissProt ID A0A0B3VQ75
NCBI RefSeq WP_003017317.1
EMBL-CDSAJI51323.1
UniProtKB Sequence >tr|A0A0B3VQ75|A0A0B3VQ75_FRATU Succinate dehydrogenase iron-sulfur subunit OS=Francisella tularensis subsp. holarctica GN=DA46_940 PE=3 SV=1 MEVRFKIYRYNPEVDKKPYYDEYTVEVENEGVKVLTALELIKEQDPTLALRRSCREGVCG SDGMNINGKNRLACITSVGELKQPIKVNPLPGLPVIRDLIVNMKQFYKNYEKVKPYLIND DEPPVKERLQSPEDRAKLDGLYECILCACCTTSCPSFWWNPDKFIGPSGLLQAYRFIADS RDTATQQRLEDLKDPFSLFRCRTIMNCVSVCPKGLNPTEAIGKIRSALLKKSV
Sequence length 233 AA
Subcellular LocationMembrane
Function Succinate dehydrogenase iron-sulfur subunit
Glycosylation Status
Glycosylation Type O- (Ser/Thr) linked
Technique(s) used for Glycosylation DetectionLectin labeling and lectin affinity chromatography
Literature
Year of Identification2010
Year of Identification Month Wise2010.4.5
ReferenceBalonova L, Hernychova L, Mann BF, Link M, Bilkova Z, Novotny MV, Stulik J. (2010) Multimethodological approach to identification of glycoproteins from the proteome of Francisella tularensis, an intracellular microorganism. J Proteome Res., 9, 1995-2005. [PMID: 20175567
AuthorBalonova L, Hernychova L, Mann BF, Link M, Bilkova Z, Novotny MV, Stulik J.
Research GroupInstitute of Molecular Pathology, Faculty of Military Health Sciences, University of Defence, Hradec Kralove, Czech Republic
Corresponding Author Stulik J.
ContactInstitute of Molecular Pathology, Faculty of Military Health Sciences, University of Defence, Hradec Kralove, Czech Republic