ProGP345

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP345
Validation Status Uncharacterized
Organism Information
Organism NameFrancisella tularensis ssp. holarctica strain FSC200
Domain Bacteria
Classification Family: Francisellaceae
Order:Thiotrichales
Class: Gammaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI) 351581
Genome Sequence(s)
GenBank CP003862.1
EMBL CP003862.1
Gene Information
Gene NameFTH_0414
GenBank Gene Sequence NC_008369.1
Protein Information
Protein NameFTH_0414
UniProtKB/SwissProt ID A0A0B6DRV9
NCBI RefSeq WP_003014685.1
EMBL-CDSAJI50771.1
UniProtKB Sequence >tr|A0A0B6DRV9|A0A0B6DRV9_FRATU Putative 17 kDa major membrane protein OS=Francisella tularensis subsp. holarctica GN=CH66_1904 PE=4 SV=1 MKKIIKLSLLSLSIAGLASCSTLGLGGSDDAKASAKDTAAAQTATTEQAAAVSKPTAKVS LNKLGQDKIKATVYTAYNNNPQGSVRLQWQAPEGSKCHDTSFPITKYAEKNDKTWATVTV KQGNNFCSGKWTANVVYDKEVIASDSINI
Sequence length 149 AA
Subcellular LocationMembrane
Function Lipoprotein TUL4 precursor
Glycosylation Status
Glycosylation Type Predicted O (Ser/Thr) linked
Experimentally Predicted Glycosites T45 and T46
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionHydrazide labeling and lectin affinity chromatography.
Literature
Year of Identification2010
Year of Identification Month Wise2010.4.5
ReferenceBalonova L, Hernychova L, Mann BF, Link M, Bilkova Z, Novotny MV, Stulik J. (2010) Multimethodological approach to identification of glycoproteins from the proteome of Francisella tularensis, an intracellular microorganism. J Proteome Res., 9, 1995-2005. [PMID: 20175567
AuthorBalonova L1, Hernychova L, Mann BF, Link M, Bilkova Z, Novotny MV, Stulik J.
Research GroupInstitute of Molecular Pathology, Faculty of Military Health Sciences, University of Defence, Hradec Kralove, Czech Republic
Corresponding Author Stulik J.
ContactInstitute of Molecular Pathology, Faculty of Military Health Sciences, University of Defence, Hradec Kralove, Czech Republic