ProGP352

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP352
Validation Status Characterized
Organism Information
Organism NameTannerella forsythia ATCC 43037
Domain Bacteria
Classification Family: Porphyromonadaceae
Order: "Bacteroidales"
Class: Bacteroidia
Division or phylum: "Bacteroidetes"
Taxonomic ID (NCBI) 203275
Genome Sequence(s)
GenBank GQ856797 
EMBL GQ856797 
Gene Information
Gene NametfsB (TF2663)
Protein Information
Protein NameTfsB (S-layer protein)
UniProtKB/SwissProt ID A0A1D3UN43
EMBL-CDSSCQ21562.1.
UniProtKB Sequence >tr|A0A1D3UN43|A0A1D3UN43_TANFO S-layer protein subunit OS=Tannerella forsythia GN=tfsB PE=4 SV=1 MNKKIFTLLAGAFMGFAAVSSVTAQIALEQQQLRVKPYDNAKPTLKFKEGANDGYYYLQV DSMVAYDKVTKRQKMIGFTPKKTPWPGVIPLDSFGTIRRGVTLYMGPDSAGQNALWIDVM GRLSGTTPGPRVPSAYPNTASIALESAAGLWCVTIQKYYQGQNPTFDFTNKLQRMMLEVN VYGHESWPKDVDGWRKSNYKSSSNPNAQTPGSISAWEFSETYKTGVKGGRPLVSYLDETM DTVAVLVGDTLNKLGYVQVKIAPATDVKAGKINGMLLFTLKEAMPFALDKKSFETVLGTQ ASQEARSLKFSPNGTPNPFTDQKWEVEYLDGISPVTAMLIDSSAWTNPWETNYRAWDVAP ISQVGTAGNPWFSVDVRHMGQMGYVRLKNAGKYLYVDTVYYNSGNSQFLKFNQNATFPGD RNPMIGQFVWRMVYYPSGDSIYINPFSATYLPTYDPKAITDSTRFATNSVVRSWYTFTAY PTPKLMADTLPRYNQNGLSHPALQVPVDERMTARLKWGVNPKRKIGAVTPGAGAPIDYSY YHRLYVSLQNLTVDGKPGTRVTLHNTKENGKINTQINFGCYEPCKMATSDRVSIDPDLYL IRNERGQYLHVPLYSAHDSAVWVFLDKNVHPEELPSFQWIVEKRFKNAEASPINIINREF GQINKGGMYAGNYGLAFMDIQLKKDQHAPFKGRTKTWGWNKQIVNSEVIDFEKTKNNMSA KKAPTFIRLPKQYKNNPNLGYQWINRDTATVNLYAFNYRSGIDNTKYLSVKASIFDGTGR DSLIYVQGTNCFDIAYFRIDTVNVDAGHYKPYGYGVKAGAESPSVWKKNQVADLVQLKRQ AYRIKYENPFKYCLGALKLSNGEQYRYSLSSRLRYNEVIGTPLFFLRDVYMEEDGVKDFA LVQIIDTFSIQSTGGGLTPSAQLEKYLKEHLGAQLTSLIMGNLKKAGEFNPGVFVAAVEE QAPMKLKYTYRGDVQTRVSTFRLKRDADPIYRRFNTELEGDKPGDTPETVKFYTTRSAPT GKNYLFENTNALKDQQAYYRAKKNYLGLVSINSNPNVKTAIYVDTAYVNRGTGHIKPQYM LMIRPTIVEDTLGCDDNGDLTIPLPGYRRGMYLINATDSAKADAGTPNENDYLWGTAWNR LVFTDAIHANDALYILGHADLKGLYTKINLKGEKMLDLKKLDAASDSSPAAPKNGKIRKI ALNNNFHKDCVFSFRLIERKSCDKEGGDFLIESETQDRGQYPVIAPCDGGWIKIQNGVPV ISRSDVLQAIADAEIFNVEKTKEDPVANEITPAITEVKVVAENGAVTILNAAGKKVVVSN VLGQTLVNTVLTSDRATVAAPQGVVVVVVEGQPAVKAMVK
Sequence length 1360 AA
Function S-layer helps T. forsythia in adhesion/invasion to human gingival epithelial cells and to epidermal carcinoma cells of the mouth. The host immune response to this pathogen is attenuated by the S-layer after immune evasion.
Glycosylation Status
Glycosylation Type O- (Ser/Thr) linked
Experimentally Validated Glycosite(s) in Full Length ProteinS473, T493, T752, T786, T1069
Glycosite(s) Annotated Protein Sequence >tr|A0A1D3UN43|A0A1D3UN43_TANFO S-layer protein subunit OS=Tannerella forsythia GN=tfsB PE=4 SV=1 MNKKIFTLLAGAFMGFAAVSSVTAQIALEQQQLRVKPYDNAKPTLKFKEGANDGYYYLQV DSMVAYDKVTKRQKMIGFTPKKTPWPGVIPLDSFGTIRRGVTLYMGPDSAGQNALWIDVM GRLSGTTPGPRVPSAYPNTASIALESAAGLWCVTIQKYYQGQNPTFDFTNKLQRMMLEVN VYGHESWPKDVDGWRKSNYKSSSNPNAQTPGSISAWEFSETYKTGVKGGRPLVSYLDETM DTVAVLVGDTLNKLGYVQVKIAPATDVKAGKINGMLLFTLKEAMPFALDKKSFETVLGTQ ASQEARSLKFSPNGTPNPFTDQKWEVEYLDGISPVTAMLIDSSAWTNPWETNYRAWDVAP ISQVGTAGNPWFSVDVRHMGQMGYVRLKNAGKYLYVDTVYYNSGNSQFLKFNQNATFPGD RNPMIGQFVWRMVYYPSGDSIYINPFSATYLPTYDPKAITDSTRFATNSVVRS*(473)WYTFTAY PTPKLMADT*(493)LPRYNQNGLSHPALQVPVDERMTARLKWGVNPKRKIGAVTPGAGAPIDYSY YHRLYVSLQNLTVDGKPGTRVTLHNTKENGKINTQINFGCYEPCKMATSDRVSIDPDLYL IRNERGQYLHVPLYSAHDSAVWVFLDKNVHPEELPSFQWIVEKRFKNAEASPINIINREF GQINKGGMYAGNYGLAFMDIQLKKDQHAPFKGRTKTWGWNKQIVNSEVIDFEKTKNNMSA KKAPTFIRLPKQYKNNPNLGYQWINRDTAT*(786)VNLYAFNYRSGIDNTKYLSVKASIFDGTGR DSLIYVQGTNCFDIAYFRIDTVNVDAGHYKPYGYGVKAGAESPSVWKKNQVADLVQLKRQ AYRIKYENPFKYCLGALKLSNGEQYRYSLSSRLRYNEVIGTPLFFLRDVYMEEDGVKDFA LVQIIDTFSIQSTGGGLTPSAQLEKYLKEHLGAQLTSLIMGNLKKAGEFNPGVFVAAVEE QAPMKLKYTYRGDVQTRVSTFRLKRDADPIYRRFNTELEGDKPGDTPETVKFYTTRSAPT GKNYLFENTNALKDQQAYYRAKKNYLGLVSINSNPNVKTAIYVDTAYVNRGT*(1069)GHIKPQYM LMIRPTIVEDTLGCDDNGDLTIPLPGYRRGMYLINATDSAKADAGTPNENDYLWGTAWNR LVFTDAIHANDALYILGHADLKGLYTKINLKGEKMLDLKKLDAASDSSPAAPKNGKIRKI ALNNNFHKDCVFSFRLIERKSCDKEGGDFLIESETQDRGQYPVIAPCDGGWIKIQNGVPV ISRSDVLQAIADAEIFNVEKTKEDPVANEITPAITEVKVVAENGAVTILNAAGKKVVVSN VLGQTLVNTVLTSDRATVAAPQGVVVVVVEGQPAVKAMVK
Sequence Around Glycosites (21 AA) TTRFATNSVVRSWYTFTAYPTP
AYPTPKLMADTLPRYNQNGLS
GYQWINRDTATVNLYAFNYRS
GRDSLIYVQGTNCFDIAYFR
YVDTAYVNRGTGHIKPQYMLM
Technique(s) used for Glycosylation DetectionPro-Q Emerald carbohydrate staining
Protein Glycosylation- Implication Here, the protein O-glycosylation system is needed for creating a rich glycoproteome that is possibly related to the virulence of this bacterium.
Glycan Information
Glycan Annotation An oligosaccharide with the structure 4-Me-β-ManpNAcCONH2-(1→3)-[Pse5Am7Gc-(2→4)-]-β-ManpNAcA-(1→4)-[4-Me-α-Galp-(1→2)-]-α-Fucp-(1→4)-[-α-Xylp-(1→3)-]-β-GlcpA-(1→3)-[-β-Digp-(1→2)-]-α-Galp.
Literature
Year of Identification2011
Year of Identification Month Wise2011.2.4
Year of Validation 2011
Reference Posch G, Pabst M, Brecker L, Altmann F, Messner P, Schäffer C. (201Characterization and scope of S-layer protein O-glycosylation in Tannerella forsythia. J Biol Chem., 286, 38714-24. [PMID: 21911490]
Author Posch G, Pabst M, Brecker L, Altmann F, Messner P, Schäffer C.
Research GroupDepartment of NanoBiotechnology, NanoGlycobiology, Vienna Institute of BioTechnology, University of Natural Resources and Applied Life Sciences, Vienna, Muthgasse 11, A-1190 Vienna, Austria.
Corresponding Author Schäffer C.
ContactDepartment of NanoBiotechnology, NanoGlycobiology, Vienna Institute of BioTechnology, University of Natural Resources and Applied Life Sciences, Vienna, Muthgasse 11, A-1190 Vienna, Austria.