ProGP353

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP353
Validation Status Characterized
Organism Information
Organism NameTannerella forsythia ATCC 43037
Domain Bacteria
Classification Family: Porphyromonadaceae
Order: "Bacteroidales"
Class: Bacteroidia
Division or phylum: "Bacteroidetes"
Taxonomic ID (NCBI) 203275
Gene Information
Gene NameTF1259
Protein Information
Protein NameTF1259
UniProtKB Sequence >KKY61076.1 hypothetical protein Tanf_08965, partial [Tannerella forsythia] MAHKDNPGNLDHGNPYFTQSQFNNLPVQNKTNGNMYLDKGSGTEYSFLNTANLPLSYYTNIHALYDKTPV SLLGVKGNYDEDNAIIHTSSTGTDNHKGVIEVGSRTTGQQRFKVYSGGVIKNYSTTACNGEACAGVFFKS GNVPEFIIKGTEPLYILNDGNCCEAAITFFNGGTAALVSAVQGANATGDLLIRAHGEVRIQDNADFDATA KNNNVSILSDQSHISTKAFGYTAAGASDLGHLTLWAKGDTFIINTPNNCGGYVSIEGNLTTTSTSTGSTW QTLTDAVQRNSGKLARRTNCSSFGEEMAARAPSALETGVQTRIQSDRDYVKVTGDFKHIGQNGGLFVQGA GKVTVNGKTEIDFKTKDGIGDAVIQSKNSSVWFNNEFSYTGNVTTDLFIDGEKGVTFNSVSGPSTIDYTQ GTDPSAHIGIQSNAGTIAFKNKAFTFKSKSTGETQLWAGANITSTDNAPLLFEYTVRNDGQNIDWYAGRD IDLSGTLTFKHDDAKDHTGFIKLRANANEAELWNHNSTDPTGRPGAGICPEICDHSDNGIHGNIYLRNDV KVNYWGKENVWMAANHDIHIQRNYTHVAGGAGQDPQGFTRFVAGNDIVTGKIGDPNSTFSYLHVGEKGER IRHFDMKAGHDIITHNHVKIGYNAATDDAFNTTLFACNDIDIRNSFWYADSSTTNKGKWTRLYANRDILS NQTCLNYGAPINFYTPDNTKTEWNVGRNIITGDTVNFRYGNTQKKVSNLSLVAQGGNIEMRRWTNINYDS DSLILISAERNKDYSVAKAAGLTANGHKSNGGSPDNARFIHDGHIYSNDSLKITRTNDEDGKTGIYADYH IRTAMVNILDSSAMNKNNTAIESHLGDIWLGYSVSPYPCPTPGQTTLGYDINRFIYKNLGSTNNQSLLIR AGYQDQSNTTRYGGGNIYVAQMKNELTTGGTTDTEISIPFSNEYLCGSTWSPDFLYNRKDSSMMMYEHAG IIFGLGRCGEDKNIDKYAPAQNLASGNKVTKTSLIYRGNKGNLKVDAGTRGNIILNKGGLINFQDPQNTG NVTFRTRFGDIDMRDPFNADSIAGSLLFLAQTENLSDLSKVGYCGCEEERNNVYLQDFQYKAHGASGSIF VGADNNIKLNYGGLQNKGTRYDPFLSTDYLACPDSSVAKIGSGYQRGGGCGPMYHCDMHDSVNQARNLIL NFYQDSTNTDITSGGFAAVASDYIDVYKSLIYKGGNGSGMSAVPGAGTLHGESVAGYGLYMKTQANKNNW NTNIFKNYPKCPMGCSGFECNGGFLHMISRMTFHADARIYAHNQRVYLGSPVIESFGPMVLNTDSMSGGR TEIVIQTDSLILHDSLVVKGKKLRYRSWSGLKNDRPIIKFGYMRRTPPFTEYTKNVCGADLDVCEPCHDY IRGSKDPVHMLDTITIKFEEGAYLERLNSVVFDHTVLTFLTDSFDHVQGPPVEHARIYVDTLRVRNQVDL YADAKHERDAHFELISEEQMSSKKYAGVYTRHYHMEPVGACGRNYSELWLSDDLALDVITTSTFGGFGYQ HSDVHVENMAHLNPGFTSLRLR
Function Outer membrane protein
Glycosylation Status
Glycosylation Type O (Thr) linked
Experimentally Validated Glycosite(s) in Full Length ProteinT1082
Glycosite(s) Annotated Protein Sequence >KKY61076.1 hypothetical protein Tanf_08965, partial [Tannerella forsythia] MAHKDNPGNLDHGNPYFTQSQFNNLPVQNKTNGNMYLDKGSGTEYSFLNTANLPLSYYTNIHALYDKTPV SLLGVKGNYDEDNAIIHTSSTGTDNHKGVIEVGSRTTGQQRFKVYSGGVIKNYSTTACNGEACAGVFFKS GNVPEFIIKGTEPLYILNDGNCCEAAITFFNGGTAALVSAVQGANATGDLLIRAHGEVRIQDNADFDATA KNNNVSILSDQSHISTKAFGYTAAGASDLGHLTLWAKGDTFIINTPNNCGGYVSIEGNLTTTSTSTGSTW QTLTDAVQRNSGKLARRTNCSSFGEEMAARAPSALETGVQTRIQSDRDYVKVTGDFKHIGQNGGLFVQGA GKVTVNGKTEIDFKTKDGIGDAVIQSKNSSVWFNNEFSYTGNVTTDLFIDGEKGVTFNSVSGPSTIDYTQ GTDPSAHIGIQSNAGTIAFKNKAFTFKSKSTGETQLWAGANITSTDNAPLLFEYTVRNDGQNIDWYAGRD IDLSGTLTFKHDDAKDHTGFIKLRANANEAELWNHNSTDPTGRPGAGICPEICDHSDNGIHGNIYLRNDV KVNYWGKENVWMAANHDIHIQRNYTHVAGGAGQDPQGFTRFVAGNDIVTGKIGDPNSTFSYLHVGEKGER IRHFDMKAGHDIITHNHVKIGYNAATDDAFNTTLFACNDIDIRNSFWYADSSTTNKGKWTRLYANRDILS NQTCLNYGAPINFYTPDNTKTEWNVGRNIITGDTVNFRYGNTQKKVSNLSLVAQGGNIEMRRWTNINYDS DSLILISAERNKDYSVAKAAGLTANGHKSNGGSPDNARFIHDGHIYSNDSLKITRTNDEDGKTGIYADYH IRTAMVNILDSSAMNKNNTAIESHLGDIWLGYSVSPYPCPTPGQTTLGYDINRFIYKNLGSTNNQSLLIR AGYQDQSNTTRYGGGNIYVAQMKNELTTGGTTDTEISIPFSNEYLCGSTWSPDFLYNRKDSSMMMYEHAG IIFGLGRCGEDKNIDKYAPAQNLASGNKVTKTSLIYRGNKGNLKVDAGTRGNIILNKGGLINFQDPQNTG NVTFRTRFGDIDMRDPFNADSIAGSLLFLAQT*(1082)ENLSDLSKVGYCGCEEERNNVYLQDFQYKAHGASGSIF VGADNNIKLNYGGLQNKGTRYDPFLSTDYLACPDSSVAKIGSGYQRGGGCGPMYHCDMHDSVNQARNLIL NFYQDSTNTDITSGGFAAVASDYIDVYKSLIYKGGNGSGMSAVPGAGTLHGESVAGYGLYMKTQANKNNW NTNIFKNYPKCPMGCSGFECNGGFLHMISRMTFHADARIYAHNQRVYLGSPVIESFGPMVLNTDSMSGGR TEIVIQTDSLILHDSLVVKGKKLRYRSWSGLKNDRPIIKFGYMRRTPPFTEYTKNVCGADLDVCEPCHDY IRGSKDPVHMLDTITIKFEEGAYLERLNSVVFDHTVLTFLTDSFDHVQGPPVEHARIYVDTLRVRNQVDL YADAKHERDAHFELISEEQMSSKKYAGVYTRHYHMEPVGACGRNYSELWLSDDLALDVITTSTFGGFGYQ HSDVHVENMAHLNPGFTSLRLR
Sequence Around Glycosites (21 AA) IAGSLLFLAQTENLSDLSKVG
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionPro-Q Emerald carbohydrate staining
Glycan Information
Glycan Annotation An oligosaccharide with the structure 4-Me-β-ManpNAcCONH2-(1→3)-[Pse5Am7Gc-(2→4)-]-β-ManpNAcA-(1→4)-[4-Me-α-Galp-(1→2)-]-α-Fucp-(1→4)-[-α-Xylp-(1→3)-]-β-GlcpA-(1→3)-[-β-Digp-(1→2)-]-α-Galp.
Literature
Year of Identification2011
Year of Identification Month Wise2011.2.4
Year of Validation 2011
Reference Posch G, Pabst M, Brecker L, Altmann F, Messner P, Schäffer C. (2011) Characterization and scope of S-layer protein O-glycosylation in Tannerella forsythia. J Biol Chem., 286, 38714-24. [PMID: 21911490]
Author Posch G, Pabst M, Brecker L, Altmann F, Messner P, Schäffer C.
Research GroupDepartment of NanoBiotechnology, NanoGlycobiology, Vienna Institute of BioTechnology, Universität für Bodenkultur Wien, Muthgasse 11, A-1190 Vienna, Austria.
Corresponding Author Schäffer C.
ContactDepartment of NanoBiotechnology, NanoGlycobiology, Vienna Institute of BioTechnology, Universität für Bodenkultur Wien, Muthgasse 11, A-1190 Vienna, Austria.