ProGP353

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP353
Validation Status Characterized
Organism Information
Organism NameTannerella forsythia ATCC 43037
Domain Bacteria
Classification Family: Porphyromonadaceae
Order: "Bacteroidales"
Class: Bacteroidia
Division or phylum: "Bacteroidetes"
Taxonomic ID (NCBI) 203275
Genome Sequence(s)
GenBank GQ856797 
EMBL GQ856797 
Gene Information
Gene NameTF1259 (Tanf_08965)
GenBank Gene Sequence JUET01000092.1
Protein Information
Protein NameTF1259
NCBI RefSeq KKY61076.1
EMBL-CDSKKY61076.1
UniProtKB Sequence >UPI00062B1A4A status=active MAHKDNPGNLDHGNPYFTQSQFNNLPVQNKTNGNMYLDKGSGTEYSFLNTANLPLSYYTN IHALYDKTPVSLLGVKGNYDEDNAIIHTSSTGTDNHKGVIEVGSRTTGQQRFKVYSGGVI KNYSTTACNGEACAGVFFKSGNVPEFIIKGTEPLYILNDGNCCEAAITFFNGGTAALVSA VQGANATGDLLIRAHGEVRIQDNADFDATAKNNNVSILSDQSHISTKAFGYTAAGASDLG HLTLWAKGDTFIINTPNNCGGYVSIEGNLTTTSTSTGSTWQTLTDAVQRNSGKLARRTNC SSFGEEMAARAPSALETGVQTRIQSDRDYVKVTGDFKHIGQNGGLFVQGAGKVTVNGKTE IDFKTKDGIGDAVIQSKNSSVWFNNEFSYTGNVTTDLFIDGEKGVTFNSVSGPSTIDYTQ GTDPSAHIGIQSNAGTIAFKNKAFTFKSKSTGETQLWAGANITSTDNAPLLFEYTVRNDG QNIDWYAGRDIDLSGTLTFKHDDAKDHTGFIKLRANANEAELWNHNSTDPTGRPGAGICP EICDHSDNGIHGNIYLRNDVKVNYWGKENVWMAANHDIHIQRNYTHVAGGAGQDPQGFTR FVAGNDIVTGKIGDPNSTFSYLHVGEKGERIRHFDMKAGHDIITHNHVKIGYNAATDDAF NTTLFACNDIDIRNSFWYADSSTTNKGKWTRLYANRDILSNQTCLNYGAPINFYTPDNTK TEWNVGRNIITGDTVNFRYGNTQKKVSNLSLVAQGGNIEMRRWTNINYDSDSLILISAER NKDYSVAKAAGLTANGHKSNGGSPDNARFIHDGHIYSNDSLKITRTNDEDGKTGIYADYH IRTAMVNILDSSAMNKNNTAIESHLGDIWLGYSVSPYPCPTPGQTTLGYDINRFIYKNLG STNNQSLLIRAGYQDQSNTTRYGGGNIYVAQMKNELTTGGTTDTEISIPFSNEYLCGSTW SPDFLYNRKDSSMMMYEHAGIIFGLGRCGEDKNIDKYAPAQNLASGNKVTKTSLIYRGNK GNLKVDAGTRGNIILNKGGLINFQDPQNTGNVTFRTRFGDIDMRDPFNADSIAGSLLFLA QTENLSDLSKVGYCGCEEERNNVYLQDFQYKAHGASGSIFVGADNNIKLNYGGLQNKGTR YDPFLSTDYLACPDSSVAKIGSGYQRGGGCGPMYHCDMHDSVNQARNLILNFYQDSTNTD ITSGGFAAVASDYIDVYKSLIYKGGNGSGMSAVPGAGTLHGESVAGYGLYMKTQANKNNW NTNIFKNYPKCPMGCSGFECNGGFLHMISRMTFHADARIYAHNQRVYLGSPVIESFGPMV LNTDSMSGGRTEIVIQTDSLILHDSLVVKGKKLRYRSWSGLKNDRPIIKFGYMRRTPPFT EYTKNVCGADLDVCEPCHDYIRGSKDPVHMLDTITIKFEEGAYLERLNSVVFDHTVLTFL TDSFDHVQGPPVEHARIYVDTLRVRNQVDLYADAKHERDAHFELISEEQMSSKKYAGVYT RHYHMEPVGACGRNYSELWLSDDLALDVITTSTFGGFGYQHSDVHVENMAHLNPGFTSLR LR
Sequence length 1562 AA
Function Outer membrane protein
Glycosylation Status
Glycosylation Type O- (Thr) linked
Experimentally Validated Glycosite(s) in Full Length ProteinT1082
Glycosite(s) Annotated Protein Sequence >KKY61076.1 hypothetical protein Tanf_08965, partial [Tannerella forsythia] MAHKDNPGNLDHGNPYFTQSQFNNLPVQNKTNGNMYLDKGSGTEYSFLNTANLPLSYYTNIHALYDKTPV SLLGVKGNYDEDNAIIHTSSTGTDNHKGVIEVGSRTTGQQRFKVYSGGVIKNYSTTACNGEACAGVFFKS GNVPEFIIKGTEPLYILNDGNCCEAAITFFNGGTAALVSAVQGANATGDLLIRAHGEVRIQDNADFDATA KNNNVSILSDQSHISTKAFGYTAAGASDLGHLTLWAKGDTFIINTPNNCGGYVSIEGNLTTTSTSTGSTW QTLTDAVQRNSGKLARRTNCSSFGEEMAARAPSALETGVQTRIQSDRDYVKVTGDFKHIGQNGGLFVQGA GKVTVNGKTEIDFKTKDGIGDAVIQSKNSSVWFNNEFSYTGNVTTDLFIDGEKGVTFNSVSGPSTIDYTQ GTDPSAHIGIQSNAGTIAFKNKAFTFKSKSTGETQLWAGANITSTDNAPLLFEYTVRNDGQNIDWYAGRD IDLSGTLTFKHDDAKDHTGFIKLRANANEAELWNHNSTDPTGRPGAGICPEICDHSDNGIHGNIYLRNDV KVNYWGKENVWMAANHDIHIQRNYTHVAGGAGQDPQGFTRFVAGNDIVTGKIGDPNSTFSYLHVGEKGER IRHFDMKAGHDIITHNHVKIGYNAATDDAFNTTLFACNDIDIRNSFWYADSSTTNKGKWTRLYANRDILS NQTCLNYGAPINFYTPDNTKTEWNVGRNIITGDTVNFRYGNTQKKVSNLSLVAQGGNIEMRRWTNINYDS DSLILISAERNKDYSVAKAAGLTANGHKSNGGSPDNARFIHDGHIYSNDSLKITRTNDEDGKTGIYADYH IRTAMVNILDSSAMNKNNTAIESHLGDIWLGYSVSPYPCPTPGQTTLGYDINRFIYKNLGSTNNQSLLIR AGYQDQSNTTRYGGGNIYVAQMKNELTTGGTTDTEISIPFSNEYLCGSTWSPDFLYNRKDSSMMMYEHAG IIFGLGRCGEDKNIDKYAPAQNLASGNKVTKTSLIYRGNKGNLKVDAGTRGNIILNKGGLINFQDPQNTG NVTFRTRFGDIDMRDPFNADSIAGSLLFLAQT*(1082)ENLSDLSKVGYCGCEEERNNVYLQDFQYKAHGASGSIF VGADNNIKLNYGGLQNKGTRYDPFLSTDYLACPDSSVAKIGSGYQRGGGCGPMYHCDMHDSVNQARNLIL NFYQDSTNTDITSGGFAAVASDYIDVYKSLIYKGGNGSGMSAVPGAGTLHGESVAGYGLYMKTQANKNNW NTNIFKNYPKCPMGCSGFECNGGFLHMISRMTFHADARIYAHNQRVYLGSPVIESFGPMVLNTDSMSGGR TEIVIQTDSLILHDSLVVKGKKLRYRSWSGLKNDRPIIKFGYMRRTPPFTEYTKNVCGADLDVCEPCHDY IRGSKDPVHMLDTITIKFEEGAYLERLNSVVFDHTVLTFLTDSFDHVQGPPVEHARIYVDTLRVRNQVDL YADAKHERDAHFELISEEQMSSKKYAGVYTRHYHMEPVGACGRNYSELWLSDDLALDVITTSTFGGFGYQ HSDVHVENMAHLNPGFTSLRLR
Sequence Around Glycosites (21 AA) IAGSLLFLAQTENLSDLSKVG
Technique(s) used for Glycosylation DetectionPro-Q Emerald carbohydrate staining
Glycan Information
Glycan Annotation An oligosaccharide with the structure 4-Me-β-ManpNAcCONH2-(1→3)-[Pse5Am7Gc-(2→4)-]-β-ManpNAcA-(1→4)-[4-Me-α-Galp-(1→2)-]-α-Fucp-(1→4)-[-α-Xylp-(1→3)-]-β-GlcpA-(1→3)-[-β-Digp-(1→2)-]-α-Galp.
Literature
Year of Identification2011
Year of Identification Month Wise2011.2.4
Year of Validation 2011
Reference Posch G, Pabst M, Brecker L, Altmann F, Messner P, Schäffer C. (201Characterization and scope of S-layer protein O-glycosylation in Tannerella forsythia. J Biol Chem., 286, 38714-24. [PMID: 21911490]
Author Posch G, Pabst M, Brecker L, Altmann F, Messner P, Schäffer C.
Research GroupDepartment of NanoBiotechnology, NanoGlycobiology, Vienna Institute of BioTechnology, University of Natural Resources and Applied Life Sciences, Vienna, Muthgasse 11, A-1190 Vienna, Austria.
Corresponding Author Schäffer C.
ContactDepartment of NanoBiotechnology, NanoGlycobiology, Vienna Institute of BioTechnology, University of Natural Resources and Applied Life Sciences, Vienna, Muthgasse 11, A-1190 Vienna, Austria.