
Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP358
Validation Status Characterized
Organism Information
Organism NameCampylobacter jejuni HB93-13
Domain Bacteria
Classification Family: Campylobacteraceae
Order: "Campylobacterales"
Class: "Epsilonproteobacteria"
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI) 192222
Genome Sequence(s)
GenBank NC_002163.1. 
EMBL AL111168 
Gene Information
Gene Namecj0011c
NCBI Gene ID 904332
GenBank Gene Sequence NC_002163.1. 
Protein Information
Protein NamePutative non-specific DNA-binding protein
UniProtKB/SwissProt ID Q0PCB4
NCBI RefSeq WP_002853093.1. 
UniProtKB Sequence >tr|Q0PCB4|Q0PCB4_CAMJE Putative non-specific DNA binding protein. Functional classification-Synthesis and modification of macromolecules-DNA replication,restriction/modification, recombination and repair OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=Cj0011c PE=4 SV=1 MKKLLFLFFALTAFLFGAVNINTATLKELKSLNGIGEAKAKAILEYRKEANFTSIDDLKK VKGIGDKLFEKIKNDITIE
Sequence length 79 AA
Glycosylation Status
Glycosylation Type N (Asn) linked
Experimentally Validated Glycosite(s) in Full Length ProteinN51
Glycosite(s) Annotated Protein Sequence >tr|Q0PCB4|Q0PCB4_CAMJE Putative non-specific DNA binding protein. Functional classification-Synthesis and modification of macromolecules-DNA replication,restriction/modification, recombination and repair OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=Cj0011c PE=4 SV=1 MKKLLFLFFALTAFLFGAVNINTATLKELKSLNGIGEAKAKAILEYRKEAN*(51)FTSIDDLKK VKGIGDKLFEKIKNDITIE
Sequence Around Glycosites (21 AA) KAILEYRKEANFTSIDDLKKV
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionZIC-HILIC enrichment
Technique(s) used for Glycosylated Residue(s) Detection Reversed Phase LC-Tandem CID/HCD-MS and CID/ETD-MS
Glycan Information
Glycan Annotation Heptasaccharide GalNAc- α1,4-GalNAc- α1,4-(Glc β1,3)-GalNAc- α1,4-GalNAc- α1,4-GalNAc- α1,3-Bac- β1 where Bac is bacillosamine (2,4-diacetamido-2,4,6-trideoxyglucopyranose)
Technique(s) used for Glycan Identification Reversed Phase LC-Tandem CID/HCD-MS
Year of Identification2011
Year of Identification Month Wise2011.2.10
Year of Validation 2011
ReferenceScott NE, Parker BL, Connolly AM, Paulech J, Edwards AV, Crossett B, Falconer L, Kolarich D, Djordjevic SP, Højrup P, Packer NH, Larsen MR, Cordwell SJ. (2011) Simultaneous glycan-peptide characterization using hydrophilic interaction chromatography and parallel fragmentation by CID, higher energy collisional dissociation, and electron transfer dissociation MS applied to the N-linked glycoproteome of Campylobacter jejuni. Mol Cell Proteomics. 2011 Feb;10(2):M000031-MCP201.
AuthorScott NE, Parker BL, Connolly AM, Paulech J, Edwards AV, Crossett B, Falconer L, Kolarich D, Djordjevic SP, Højrup P, Packer NH, Larsen MR, Cordwell SJ
Research GroupSchool of Molecular and Microbial Biosciences, University of Sydney, Sydney, Australia
Corresponding Author Cordwell SJ
ContactSchool of Molecular and Microbial Biosciences, University of Sydney, Sydney, Australia