ProGP360 (Cj0235c (Putative protein export protein

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP360 (Cj0235c (Putative protein export protein
Validation Status Characterized
Organism Information
Organism NameCampylobacter jejuni HB93-13
Domain Bacteria
Classification Family: Campylobacteraceae
Order: "Campylobacterales"
Class: "Epsilonproteobacteria"
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI) 192222
Genome Information
GenBank NC_002163.1.
EMBL AL111168
Organism Additional Information Campylobacter jejuni is a microaerophilic, Gram-negative, human pathogen that is the major cause of bacterial food-borne diarrhoea (gastroenteritis). It is most frequently responsible for a form of post-infection neuromuscular paralysis known as Guillain Barre' syndrome. It also leads to an immunoproliferative small intestine disease that is a rare malignant lymphoma of the intestine. Motility is essential for pathogenicity.
Gene Information
Gene NamesecG
NCBI Gene ID 904562.
GenBank Gene Sequence NC_002163.1.
Protein Information
Protein NameCj0235c (Putative protein export protein)
UniProtKB/SwissProt ID Q0PBR9
NCBI RefSeq WP_002851915.1
EMBL-CDSCAL34390.1.
UniProtKB Sequence >tr|Q0PBR9|Q0PBR9_CAMJE Uncharacterized protein OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=secG PE=4 SV=1 MITLLIILQFIIVVVICIAVLLQKSSSIGLGAYSGSNESLFGAKGPAGFLAKFTFVMGIL LIANTIGLGYLYNKASKDSLAEKIKVENNNTTIPSAPIVPTTPNTNSIAPSAPQLPSDVN SSK
Sequence length 123 AA
Glycosylation Status
Glycosylation Type N- (Asn) linked
Experimentally Validated Glycosite(s) in Full Length ProteinN120
Glycosite(s) Annotated Protein Sequence >tr|Q0PBR9|Q0PBR9_CAMJE Uncharacterized protein OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=secG PE=4 SV=1 MITLLIILQFIIVVVICIAVLLQKSSSIGLGAYSGSNESLFGAKGPAGFLAKFTFVMGIL LIANTIGLGYLYNKASKDSLAEKIKVENNNTTIPSAPIVPTTPNTNSIAPSAPQLPSDVN*(120) SSK
Technique(s) used for Glycosylation DetectionZIC-HILIC enrichment
Technique(s) used for Glycosylated Residue(s) Detection Reversed Phase LC-Tandem CID/HCD-MS
Glycan Information
Glycan Annotation Heptasaccharide GalNAc- α1,4-GalNAc- α1,4-(Glc β1,3)-GalNAc- α1,4-GalNAc- α1,4-GalNAc- α1,3-Bac- β1 where Bac is bacillosamine (2,4-diacetamido-2,4,6-trideoxyglucopyranose)
BCSDB ID20059
Technique(s) used for Glycan Identification Reversed Phase LC-Tandem CID/HCD-MS
Literature
Year of Identification2011
Year of Identification Month Wise2011.2.10
Year of Validation 2011