ProGP365 (Cj0366c (Inner membrane multidrug efflux system protein CmeB))

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP365 (Cj0366c (Inner membrane multidrug efflux system protein CmeB))
Validation Status Characterized
Organism Information
Organism NameCampylobacter jejuni HB93-13
Domain Bacteria
Classification Family: Campylobacteraceae
Order: "Campylobacterales"
Class: "Epsilonproteobacteria"
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI) 192222
Genome Information
GenBank NC_002163.1.
EMBL AL111168
Organism Additional Information Campylobacter jejuni is a microaerophilic, Gram-negative, human pathogen that is the major cause of bacterial food-borne diarrhoea (gastroenteritis). It is most frequently responsible for a form of post-infection neuromuscular paralysis known as Guillain Barre' syndrome. It also leads to an immunoproliferative small intestine disease that is a rare malignant lymphoma of the intestine. Motility is essential for pathogenicity.
Gene Information
Gene NamecmeB
NCBI Gene ID 904689.
GenBank Gene Sequence NC_002163.1.
Protein Information
Protein NameCj0366c (Inner membrane multidrug efflux system protein CmeB)
UniProtKB/SwissProt ID Q0PBE4
NCBI RefSeq WP_002872052.1
EMBL-CDSCAL34516.1.
UniProtKB Sequence >tr|Q0PBE4|Q0PBE4_CAMJE Inner membrane efflux transporter CmeB (Multidrug efflux system CmeABC) OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=cmeB PE=3 SV=1 MFSKFFIERPVFASVVAIIISLAGAIGLTNLPIEQYPSLTPPTVKVSATYTGADAQTIAS TVASPIEDAINGADNMIYMDSTSSSSGTMSLTVYFDIGTDPDQATIDVNNRISAATAKMP DAVKKLGVTVRKTSSTTLAAISMYSSDGSMSAVDVYNYITLNVLDELKRVPGVGDANAIG NRNYSLRIWLKPDLLNKFGITATDVISAVNDQNAQYATGKIGEEPVTQKSPYVYSITMQG RLQNPSEFENIILRTNNDGSFLRLKDVADVEIGSQQYSSQGRLNGNDAVPIMINLQSGAN ALHTAELVQAKMQELSKNFPKGLTYKIPYDTTKFVIESIKEVVKTFVEALILVIIVMYMF LKNFRATLIPMIAVPVSLLGTFAGLYVLGFSINLLTLFALILAIGIVVDDAIIVVENIDR ILHENEQISVKDAAIQAMQEVSSPVISIVLVLCAVFVPVSFISGFVGEIQRQFALTLAIS VTISGFVALTLTPSLCALFLRRNEGEPFKFVKKFNDFFDWSTSVFSAGVAYILKRTIRFV LIFCIMLGAIFYLYKAVPSSLVPEEDQGLMIGIINLPSASALHRTISEVDHISQEVLKTN GVKDAMAMIGFDLFTSSLKENAAAMFIGLKDWKDRNVSADEIAMELNKKFAFDRNASSIF IGLPPIPGLSITGGFEMYVQNKSGKSYDEIQKDVNKLVAVANQRKELSRVRTTLDTTFPQ YKLIIDRDKLKHYNLNMQDVFNTMNATIGTYYVNDFSMLGKNFQVNIRAKGDFRNTQDAL KNIFVRSNDGKMIPLDSFLTLQRSSGPDDVKRFNLFPAAQVQGQPAPGYTSGQAIEAIAQ VAKETLGDDYSIAWSGSAYQEVSSKGTASYAFALGMIFVFLILAAQYERWLIPLAVVTAV PFAVFGSFLLVYLRGFSNDIYFQTGLLLLIGLSAKNAILIVEFAMEERFKKGKGVFEAAV AAAKLRFRPIIMTSLAFTFGVLPMIFATGAGSASRHSLGTGLIGGMIAASTLAIFFVPLF FYLLENFNEWLDKKRGKVHE
Sequence length 1040 AA
Glycosylation Status
Glycosylation Type N- (Asn) linked
Experimentally Validated Glycosite(s) in Full Length ProteinN636
Glycosite(s) Annotated Protein Sequence >tr|Q0PBE4|Q0PBE4_CAMJE Inner membrane efflux transporter CmeB (Multidrug efflux system CmeABC) OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=cmeB PE=3 SV=1 MFSKFFIERPVFASVVAIIISLAGAIGLTNLPIEQYPSLTPPTVKVSATYTGADAQTIAS TVASPIEDAINGADNMIYMDSTSSSSGTMSLTVYFDIGTDPDQATIDVNNRISAATAKMP DAVKKLGVTVRKTSSTTLAAISMYSSDGSMSAVDVYNYITLNVLDELKRVPGVGDANAIG NRNYSLRIWLKPDLLNKFGITATDVISAVNDQNAQYATGKIGEEPVTQKSPYVYSITMQG RLQNPSEFENIILRTNNDGSFLRLKDVADVEIGSQQYSSQGRLNGNDAVPIMINLQSGAN ALHTAELVQAKMQELSKNFPKGLTYKIPYDTTKFVIESIKEVVKTFVEALILVIIVMYMF LKNFRATLIPMIAVPVSLLGTFAGLYVLGFSINLLTLFALILAIGIVVDDAIIVVENIDR ILHENEQISVKDAAIQAMQEVSSPVISIVLVLCAVFVPVSFISGFVGEIQRQFALTLAIS VTISGFVALTLTPSLCALFLRRNEGEPFKFVKKFNDFFDWSTSVFSAGVAYILKRTIRFV LIFCIMLGAIFYLYKAVPSSLVPEEDQGLMIGIINLPSASALHRTISEVDHISQEVLKTN GVKDAMAMIGFDLFTSSLKENAAAMFIGLKDWKDRN*(636)VSADEIAMELNKKFAFDRNASSIF IGLPPIPGLSITGGFEMYVQNKSGKSYDEIQKDVNKLVAVANQRKELSRVRTTLDTTFPQ YKLIIDRDKLKHYNLNMQDVFNTMNATIGTYYVNDFSMLGKNFQVNIRAKGDFRNTQDAL KNIFVRSNDGKMIPLDSFLTLQRSSGPDDVKRFNLFPAAQVQGQPAPGYTSGQAIEAIAQ VAKETLGDDYSIAWSGSAYQEVSSKGTASYAFALGMIFVFLILAAQYERWLIPLAVVTAV PFAVFGSFLLVYLRGFSNDIYFQTGLLLLIGLSAKNAILIVEFAMEERFKKGKGVFEAAV AAAKLRFRPIIMTSLAFTFGVLPMIFATGAGSASRHSLGTGLIGGMIAASTLAIFFVPLF FYLLENFNEWLDKKRGKVHE
Sequence Around Glycosites (21 AA) FIGLKDWKDRNVSADEIAMEL
Technique(s) used for Glycosylation DetectionZIC-HILIC enrichment
Technique(s) used for Glycosylated Residue(s) Detection Reversed Phase LC-Tandem CID/HCD-MS and CID/ETD-MS
Glycan Information
Glycan Annotation Heptasaccharide GalNAc- α1,4-GalNAc- α1,4-(Glc β1,3)-GalNAc- α1,4-GalNAc- α1,4-GalNAc- α1,3-Bac- β1 where Bac is bacillosamine (2,4-diacetamido-2,4,6-trideoxyglucopyranose)
BCSDB ID20059
GlyTouCanG38348FF
Technique(s) used for Glycan Identification Reversed Phase LC-Tandem CID/HCD-MS
Literature
Year of Identification2011
Year of Identification Month Wise2011.2.10
Year of Validation 2011
ReferenceScott NE, Parker BL, Connolly AM, Paulech J, Edwards AV, Crossett B, Falconer L, Kolarich D, Djordjevic SP, Højrup P, Packer NH, Larsen MR, Cordwell SJ. (2011) Simultaneous glycan-peptide characterization using hydrophilic interaction chromatography and parallel fragmentation by CID, higher energy collisional dissociation, and electron transfer dissociation MS applied to the N-linked glycoproteome of Campylobacter jejuni. Mol Cell Proteomics., 10(2):M000031-MCP201. [PubMed: 20360033]
AuthorScott NE, Parker BL, Connolly AM, Paulech J, Edwards AV, Crossett B, Falconer L, Kolarich D, Djordjevic SP, Højrup P, Packer NH, Larsen MR, Cordwell SJ
Research GroupSchool of Molecular and Microbial Biosciences, University of Sydney, Sydney, Australia
Corresponding Author Cordwell SJ
ContactSchool of Molecular and Microbial Biosciences, University of Sydney, Sydney, Australia