ProGP365 (Cj0366c (Inner membrane multidrug efflux

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP365 (Cj0366c (Inner membrane multidrug efflux
Validation Status Characterized
Organism Information
Organism NameCampylobacter jejuni HB93-13
Domain Bacteria
Classification Family: Campylobacteraceae
Order: "Campylobacterales"
Class: "Epsilonproteobacteria"
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI) 192222
Genome Information
GenBank NC_002163.1.
EMBL AL111168
Organism Additional Information Campylobacter jejuni is a microaerophilic, Gram-negative, human pathogen that is the major cause of bacterial food-borne diarrhoea (gastroenteritis). It is most frequently responsible for a form of post-infection neuromuscular paralysis known as Guillain Barre' syndrome. It also leads to an immunoproliferative small intestine disease that is a rare malignant lymphoma of the intestine. Motility is essential for pathogenicity.
Gene Information
Gene NamecmeB
NCBI Gene ID 904689.
GenBank Gene Sequence NC_002163.1.
Protein Information
Protein NameCj0366c (Inner membrane multidrug efflux system protein CmeB)
UniProtKB/SwissProt ID Q0PBE4
NCBI RefSeq WP_002872052.1
EMBL-CDSCAL34516.1.
UniProtKB Sequence >tr|Q0PBE4|Q0PBE4_CAMJE Inner membrane efflux transporter CmeB (Multidrug efflux system CmeABC) OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=cmeB PE=3 SV=1 MFSKFFIERPVFASVVAIIISLAGAIGLTNLPIEQYPSLTPPTVKVSATYTGADAQTIAS TVASPIEDAINGADNMIYMDSTSSSSGTMSLTVYFDIGTDPDQATIDVNNRISAATAKMP DAVKKLGVTVRKTSSTTLAAISMYSSDGSMSAVDVYNYITLNVLDELKRVPGVGDANAIG NRNYSLRIWLKPDLLNKFGITATDVISAVNDQNAQYATGKIGEEPVTQKSPYVYSITMQG RLQNPSEFENIILRTNNDGSFLRLKDVADVEIGSQQYSSQGRLNGNDAVPIMINLQSGAN ALHTAELVQAKMQELSKNFPKGLTYKIPYDTTKFVIESIKEVVKTFVEALILVIIVMYMF LKNFRATLIPMIAVPVSLLGTFAGLYVLGFSINLLTLFALILAIGIVVDDAIIVVENIDR ILHENEQISVKDAAIQAMQEVSSPVISIVLVLCAVFVPVSFISGFVGEIQRQFALTLAIS VTISGFVALTLTPSLCALFLRRNEGEPFKFVKKFNDFFDWSTSVFSAGVAYILKRTIRFV LIFCIMLGAIFYLYKAVPSSLVPEEDQGLMIGIINLPSASALHRTISEVDHISQEVLKTN GVKDAMAMIGFDLFTSSLKENAAAMFIGLKDWKDRNVSADEIAMELNKKFAFDRNASSIF IGLPPIPGLSITGGFEMYVQNKSGKSYDEIQKDVNKLVAVANQRKELSRVRTTLDTTFPQ YKLIIDRDKLKHYNLNMQDVFNTMNATIGTYYVNDFSMLGKNFQVNIRAKGDFRNTQDAL KNIFVRSNDGKMIPLDSFLTLQRSSGPDDVKRFNLFPAAQVQGQPAPGYTSGQAIEAIAQ VAKETLGDDYSIAWSGSAYQEVSSKGTASYAFALGMIFVFLILAAQYERWLIPLAVVTAV PFAVFGSFLLVYLRGFSNDIYFQTGLLLLIGLSAKNAILIVEFAMEERFKKGKGVFEAAV AAAKLRFRPIIMTSLAFTFGVLPMIFATGAGSASRHSLGTGLIGGMIAASTLAIFFVPLF FYLLENFNEWLDKKRGKVHE
Sequence length 1040 AA
Glycosylation Status
Glycosylation Type N- (Asn) linked
Experimentally Validated Glycosite(s) in Full Length ProteinN636
Glycosite(s) Annotated Protein Sequence >tr|Q0PBE4|Q0PBE4_CAMJE Inner membrane efflux transporter CmeB (Multidrug efflux system CmeABC) OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=cmeB PE=3 SV=1 MFSKFFIERPVFASVVAIIISLAGAIGLTNLPIEQYPSLTPPTVKVSATYTGADAQTIAS TVASPIEDAINGADNMIYMDSTSSSSGTMSLTVYFDIGTDPDQATIDVNNRISAATAKMP DAVKKLGVTVRKTSSTTLAAISMYSSDGSMSAVDVYNYITLNVLDELKRVPGVGDANAIG NRNYSLRIWLKPDLLNKFGITATDVISAVNDQNAQYATGKIGEEPVTQKSPYVYSITMQG RLQNPSEFENIILRTNNDGSFLRLKDVADVEIGSQQYSSQGRLNGNDAVPIMINLQSGAN ALHTAELVQAKMQELSKNFPKGLTYKIPYDTTKFVIESIKEVVKTFVEALILVIIVMYMF LKNFRATLIPMIAVPVSLLGTFAGLYVLGFSINLLTLFALILAIGIVVDDAIIVVENIDR ILHENEQISVKDAAIQAMQEVSSPVISIVLVLCAVFVPVSFISGFVGEIQRQFALTLAIS VTISGFVALTLTPSLCALFLRRNEGEPFKFVKKFNDFFDWSTSVFSAGVAYILKRTIRFV LIFCIMLGAIFYLYKAVPSSLVPEEDQGLMIGIINLPSASALHRTISEVDHISQEVLKTN GVKDAMAMIGFDLFTSSLKENAAAMFIGLKDWKDRN*(636)VSADEIAMELNKKFAFDRNASSIF IGLPPIPGLSITGGFEMYVQNKSGKSYDEIQKDVNKLVAVANQRKELSRVRTTLDTTFPQ YKLIIDRDKLKHYNLNMQDVFNTMNATIGTYYVNDFSMLGKNFQVNIRAKGDFRNTQDAL KNIFVRSNDGKMIPLDSFLTLQRSSGPDDVKRFNLFPAAQVQGQPAPGYTSGQAIEAIAQ VAKETLGDDYSIAWSGSAYQEVSSKGTASYAFALGMIFVFLILAAQYERWLIPLAVVTAV PFAVFGSFLLVYLRGFSNDIYFQTGLLLLIGLSAKNAILIVEFAMEERFKKGKGVFEAAV AAAKLRFRPIIMTSLAFTFGVLPMIFATGAGSASRHSLGTGLIGGMIAASTLAIFFVPLF FYLLENFNEWLDKKRGKVHE
Sequence Around Glycosites (21 AA) FIGLKDWKDRNVSADEIAMEL
Technique(s) used for Glycosylation DetectionZIC-HILIC enrichment
Technique(s) used for Glycosylated Residue(s) Detection Reversed Phase LC-Tandem CID/HCD-MS and CID/ETD-MS
Glycan Information
Glycan Annotation Heptasaccharide GalNAc- α1,4-GalNAc- α1,4-(Glc β1,3)-GalNAc- α1,4-GalNAc- α1,4-GalNAc- α1,3-Bac- β1 where Bac is bacillosamine (2,4-diacetamido-2,4,6-trideoxyglucopyranose)
BCSDB ID20059
Technique(s) used for Glycan Identification Reversed Phase LC-Tandem CID/HCD-MS
Literature
Year of Identification2011
Year of Identification Month Wise2011.2.10
Year of Validation 2011