ProGP402

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP402
Validation Status Characterized
Organism Information
Organism NamePseudomonas aeruginosa PAO1
Domain Bacteria
Classification Family: Pseudomonadaceae
Order: Pseudomonadales
Class: Gammaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI) 287
Genome Sequence(s)
GenBank AE004091.2
EMBL AE004091
Organism Additional Information This Gram-negative opportunistic pathogen produces LecA and LecB virulence factors at high levels. It is involved in chronic airway infections. These virulence factors have been demonstrated to play a role in P. aeruginosa-induced otitis externa diffusa and cystic fibrosis.
Gene Information
Gene NamelecB (PA3361)
NCBI Gene ID 882528
GenBank Gene Sequence 882528
Protein Information
Protein NameLectin LecB (PA-IIL is old name)
UniProtKB/SwissProt ID Q9HYN5
NCBI RefSeq NP_252051.1
EMBL-CDSAAG06749.1
UniProtKB Sequence >tr|Q9HYN5|Q9HYN5_PSEAE Fucose-binding lectin PA-IIL OS=Pseudomonas aeruginosa GN=lecB PE=1 SV=1 MATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNETAATFSGQSTNNAVIGTQVLNSGS SGKVQVQVSVNGRPSDLVSAQVILTNELNFALVGSEDGTDNDYNDAVVVINWPLG
Sequence length 115 AA
Subcellular LocationPeriplasm or outer membrane
Function LecB is a fucose-/mannose-specific lectin. It may help in the adhesion of P. aeruginosa cells to the receptors and facilitate biofilm formation resulting in host tissue colonization. This virulence factor has an important role in human infection. It inhibits the ciliary beating and hence defence mechanism of the lung. It is involved in cystic fibrosis.
Glycosylation Status
Glycosylation Type N- (Asn) linked
Experimentally Validated Glycosite(s) in Full Length ProteinN22
Experimentally Validated Glycosite(s ) in Mature ProteinN22
Glycosite(s) Annotated Protein Sequence >tr|Q9HYN5|Q9HYN5_PSEAE Fucose-binding lectin PA-IIL OS=Pseudomonas aeruginosa GN=lecB PE=1 SV=1 MATQGVFTLPANTRFGVTAFAN*(22)SSGTQTVNVLVNNETAATFSGQSTNNAVIGTQVLNSGS SGKVQVQVSVNGRPSDLVSAQVILTNELNFALVGSEDGTDNDYNDAVVVINWPLG
Sequence Around Glycosites (21 AA) NTRFGVTAFANSSGTQTVNVL
Technique(s) used for Glycosylation DetectionDeglycosylation with N-glycosidase F (PNGase F)
Technique(s) used for Glycosylated Residue(s) Detection Site-directed mutagenesis (N22A)
Protein Glycosylation- Implication LecB N glycosylation seems to be important for its production and transport to the outer membrane.
Literature
Year of Identification2011
Year of Identification Month Wise2011.2.18
Year of Validation 2011
ReferenceBartels, K.M., Funken, H., Knapp, A., Brocker, M., Bott, M., Wilhelm, S., Jaeger, K.E. and Rosenau, F. (201Glycosylation is required for outer membrane localization of the lectin LecB in Pseudomonas aeruginosa. J Bacteriol, 193, 1107-1113. [PubMed: 21217000]
AuthorBartels, K.M., Funken, H., Knapp, A., Brocker, M., Bott, M., Wilhelm, S., Jaeger, K.E. and Rosenau, F.
Research GroupInstitute of Microbiology and Biotechnology, Ulm University, Ulm, Germany.
Corresponding Author Rosenau, F.
ContactInstitute of Microbiology and Biotechnology, Ulm University, Ulm, Germany.