ProGP403

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP403
Validation Status Characterized
Organism Information
Organism NameTannerella forsythia ATCC 43037
Domain Bacteria
Classification Family: Pseudomonadaceae
Order: Bacteroidales
Class: Bacteroidia
Division or phylum: "Bacteroidetes
Taxonomic ID (NCBI) 203275
Genome Sequence(s)
GenBank GQ856797 
EMBL GQ856797 
Gene Information
Gene NametfsA (TF2661-2)
Protein Information
Protein NameTfsA (S-layer protein)
UniProtKB/SwissProt ID Q1JQR6
EMBL-CDSAAR82922.1.
UniProtKB Sequence >tr|Q1JQR6|Q1JQR6_TANFO Surface layer protein A OS=Tannerella forsythia GN=tfsA PE=4 SV=1 MNKKVFTLLAASLMLFMTAFMADARPFYGDAVKYLPEGMGKGAYHLKVTLQTATGPVDKF LAMDEFGYITLVDSAFIYGASVPADSSYRRLRAAMWCVNVTKPELYGKVPGFAFTNKEYG AGLEFEYESSMFKKMCAGMDVHSQRDLPLVGGNLGIWKFSRTYNTVPLEQEQYLAIEVKP DYYMTFAINKTCGASDSVRLVVAHKDEFDVNADFYKKDLLKFTLVNARPRVLTAKDFNTM MYEYSKEEYRQLEFSQKVSAGQVNPFEQPLMAEDVTGTTGDKQYLNLKNKDGKYVTALAG NTEENYVNDLGYRYPKIVTGGKSTSQHSDWRLVYYPSEDSLVINVRRLNHMVEGDNEDNM TYLDGEYDGLFNQTIWNFLTVRMQDLSAGERVVTVRNKPANVRGFFNINSCVLYDKNRTT VEGDLYTIKDKDGRYLVVPMYAGNFTPQWLRLDENEVANMTPSYQWYVEQVNEGSSISKI HLINREFDDIRIEYVQIYNDYELFKGVWWRLDPKNKKKDYSPVMGRNFVNKESFIRVPRP YRNDPYLGYRFFSRKPSQFGKEDGGIAEATDSLNWFAYTFQYLSGLSGNHYMGFDEKASN KDTILYVLKGEKTYFQLVIPDSLRKEAYGTERYGIGWTSNSPLKSKFTKKGTDDYIAPLE RWYYHLQINDYWKFKRNEYYLVLDDNGRYGYTPEVIANARKLNKAKFYLRFTYQVDGKNY YALLDRIDLSNFHYYTDITGLPITDTVRVHDTSHGSIKNNSFGVVHASVDDLNNYVRSQP KTVGGQRVSTFAISCETEPLYRRFNTTDESAIGSDNPDTLKFHRTAVGKEREYLYEDAHS IYSYDIKRLPGKNHSSVNFLGVQNEDDAIANKDKDQVFKRHLDTDWAIYVDTAYVNRGTG HIKPQYLLAVDPKFGYLGCPVCGEDQLNRPFVYARYLRNQTDSARLAGHPDGTIVDKDYI WDAKWERLSFVPAIHAGDTLYILNGRPIEAFIQKKKEADGTETEYVNYKKLRNDSKVKIV FLGNNKHKDEVFSFRFTEVGGGSNKDFMIESETTRRDVTKGRMIAPMNGGWVKIQNGVPV ISRGAYTDWIAEAETWNVKMTKKSPLANAEASVTDVKVVAGAGEVMIRNASGKKVTVSNI LGQTIAKVVLTSDNQTIAAPQGVVVVAIEGENAVKAVVK
Sequence length 1179AA
Function S-layer helps T. forsythia in adhesion/invasion to human gingival epithelial cells and to epidermal carcinoma cells of the mouth. The host immune response to this pathogen is attenuated by the S-layer after immune evasion.
Glycosylation Status
Glycosylation Type O- (Ser/Thr) linked
Experimentally Validated Glycosite(s) in Full Length ProteinS197, T819, S943, T979
Glycosite(s) Annotated Protein Sequence >tr|Q1JQR6|Q1JQR6_TANFO Surface layer protein A OS=Tannerella forsythia GN=tfsA PE=4 SV=1 MNKKVFTLLAASLMLFMTAFMADARPFYGDAVKYLPEGMGKGAYHLKVTLQTATGPVDKF LAMDEFGYITLVDSAFIYGASVPADSSYRRLRAAMWCVNVTKPELYGKVPGFAFTNKEYG AGLEFEYESSMFKKMCAGMDVHSQRDLPLVGGNLGIWKFSRTYNTVPLEQEQYLAIEVKP DYYMTFAINKTCGASDS*(197)VRLVVAHKDEFDVNADFYKKDLLKFTLVNARPRVLTAKDFNTM MYEYSKEEYRQLEFSQKVSAGQVNPFEQPLMAEDVTGTTGDKQYLNLKNKDGKYVTALAG NTEENYVNDLGYRYPKIVTGGKSTSQHSDWRLVYYPSEDSLVINVRRLNHMVEGDNEDNM TYLDGEYDGLFNQTIWNFLTVRMQDLSAGERVVTVRNKPANVRGFFNINSCVLYDKNRTT VEGDLYTIKDKDGRYLVVPMYAGNFTPQWLRLDENEVANMTPSYQWYVEQVNEGSSISKI HLINREFDDIRIEYVQIYNDYELFKGVWWRLDPKNKKKDYSPVMGRNFVNKESFIRVPRP YRNDPYLGYRFFSRKPSQFGKEDGGIAEATDSLNWFAYTFQYLSGLSGNHYMGFDEKASN KDTILYVLKGEKTYFQLVIPDSLRKEAYGTERYGIGWTSNSPLKSKFTKKGTDDYIAPLE RWYYHLQINDYWKFKRNEYYLVLDDNGRYGYTPEVIANARKLNKAKFYLRFTYQVDGKNY YALLDRIDLSNFHYYTDITGLPITDTVRVHDTSHGSIKNNSFGVVHASVDDLNNYVRSQP KTVGGQRVSTFAISCETEPLYRRFNTTDESAIGSDNPDT*(819)LKFHRTAVGKEREYLYEDAHS IYSYDIKRLPGKNHSSVNFLGVQNEDDAIANKDKDQVFKRHLDTDWAIYVDTAYVNRGTG HIKPQYLLAVDPKFGYLGCPVCGEDQLNRPFVYARYLRNQTDS*(943)ARLAGHPDGTIVDKDYI WDAKWERLSFVPAIHAGDT*(979)LYILNGRPIEAFIQKKKEADGTETEYVNYKKLRNDSKVKIV FLGNNKHKDEVFSFRFTEVGGGSNKDFMIESETTRRDVTKGRMIAPMNGGWVKIQNGVPV ISRGAYTDWIAEAETWNVKMTKKSPLANAEASVTDVKVVAGAGEVMIRNASGKKVTVSNI LGQTIAKVVLTSDNQTIAAPQGVVVVAIEGENAVKAVVK
Sequence Around Glycosites (21 AA) AINKTCGASDSVRLVVAHKDE
ESAIGSDNPDTLKFHRTAVGK
YARYLRNQTDSARLAGHPDGT
SFVPAIHAGDTLYILNGRPIE
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionPro-Q Emerald carbohydrate staining
Protein Glycosylation- Implication Here, the protein O-glycosylation system is needed for creating a rich glycoproteome that is possibly related to the virulence of this bacterium.
Glycan Information
Glycan Annotation An oligosaccharide with the structure 4-Me-β-ManpNAcCONH2-(1→3)-[Pse5Am7Gc-(2→4)-]-β-ManpNAcA-(1→4)-[4-Me-α-Galp-(1→2)-]-α-Fucp-(1→4)-[-α-Xylp-(1→3)-]-β-GlcpA-(1→3)-[-β-Digp-(1→2)-]-α-Galp.
Literature
Year of Identification2011
Year of Identification Month Wise2011.2.18
Year of Validation 2011
Reference Posch G, Pabst M, Brecker L, Altmann F, Messner P, Schäffer C. (201Characterization and scope of S-layer protein O-glycosylation in Tannerella forsythia. J Biol Chem., 286, 38714-24. [PMID: 21911490]
Author Posch G, Pabst M, Brecker L, Altmann F, Messner P, Schäffer C.
Research GroupDepartment of NanoBiotechnology, NanoGlycobiology, Vienna Institute of BioTechnology, University of Natural Resources and Applied Life Sciences, Vienna, Muthgasse 11, A-1190 Vienna, Austria.
Corresponding Author Schäffer C.
ContactDepartment of NanoBiotechnology, NanoGlycobiology, Vienna Institute of BioTechnology, University of Natural Resources and Applied Life Sciences, Vienna, Muthgasse 11, A-1190 Vienna, Austria.