
Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP405
Validation Status Characterized
Organism Information
Organism NameLactobacillus plantarum A-1
Domain Bacteria
Classification Family: Lactobacillaceae
Order: Lactobacillales
Class: Bacilli (or Firmibacteria)
Division or phylum: "Firmicutes"
Taxonomic ID (NCBI) 1590
Genome Sequence(s)
GenBank AB474371
EMBL AB474371
Gene Information
Gene NamebactA1
Protein Information
Protein NamePlantaricin ASM1
UniProtKB/SwissProt ID C7G1H4
Sequence length 64 AA
Subcellular LocationSecreted
Glycosylation Status
Glycosylation Type O- (Ser) linked
Experimentally Validated Glycosite(s) in Full Length Protein(Signal peptide: 1-21) S61
Experimentally Validated Glycosite(s ) in Mature ProteinS40
Glycosite(s) Annotated Protein Sequence >sp|C7G1H4|PASM1_LACPL Bacteriocin plantarican ASM1 OS=Lactobacillus plantarum GN=bactA1 PE=1 SV=1 MSKLVKTLTVDEISKIQTNGGKPAWCWYTLAMCGAGYDSGTCDYMYSHCFGVKHSSGGGG S*(61)YHC
Sequence Around Glycosites (21 AA) GVKHSSGGGGSYHC
Technique(s) used for Glycosylation DetectionDifference between the theoretical and measured masses
Technique(s) used for Glycosylated Residue(s) Detection Edman sequencing
Year of Identification2011
Year of Identification Month Wise2011.5.20
Year of Validation 2011
ReferenceStepper, J., Shastri, S., Loo, T.S., Preston, J.C., Novak, P., Man, P., Moore, C.H., Havlicek, V., Patchett, M.L. and Norris, G.E. (201Cysteine S-glycosylation, a new post-translational modification found in glycopeptide bacteriocins. FEBS Lett, 585, 645-650. [PubMed: 21251913]
AuthorStepper, J., Shastri, S., Loo, T.S., Preston, J.C., Novak, P., Man, P., Moore, C.H., Havlicek, V., Patchett, M.L. and Norris, G.E.
Research GroupInstitute of Molecular Biosciences, Massey University, Palmerston North, New Zealand.
Corresponding Author Norris, G.E
ContactInstitute of Molecular Biosciences, Massey University, Palmerston North, New Zealand.