ProGP41

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP41
Validation Status Uncharacterized
Organism Information
Organism NameDeinococcus radiodurans
Domain Bacteria
Classification Family: Deinococcaceae
Order: Deinococcales
Class: Deinococci
Division or phylum: "Deinococcus-Thermus"
Taxonomic ID (NCBI) 1299
Genome Sequence(s)
GenBank M17895
EMBL M17895
Gene Information
Gene Namehpi
Protein Information
Protein NameHPI ( hexagonally packed intermediate) layer polypepetide
UniProtKB/SwissProt ID P13126
EMBL-CDSAAA23335.1
UniProtKB Sequence >sp|P13126|HPI2_DEIRA Hexagonally packed intermediate-layer surface protein OS=Deinococcus radiodurans GN=hpi PE=1 SV=1 MKKNIALMALTGVLTLASCGQNGNTPTADTTAPTVSLSVNNANLPSGVGSVVLSGTVNEA STVVVKNNAGTTVCTVEVAASGTFTCPATTIAGNTSTTSTSTSYTATATDAAKNVGTSSV VTVNVAGVSNPAPTTAVLTIDLAGVSSAPITIKDANGNVVQGYDNVTVNDNATITVARGV YTVTAGNVSGFNGPTTNFRVDLSGGNQTVTLNYTQAGTTTPTPVGSINILTPAVGTSVTG GSTVRVTFDKANEVQCMVGGAAAVTAQVDSTSGYCDVVVPNSTGNVVITVMGKGVNGQTV TATRNISVTQAAVSYGVVTPAGDQELTLTSEGIVRDADSGWRRLGQGVSTPSDPNLNLDI YIKGTVNFSVNAPAGQKVELFLARTTGSDVPTNDDIQAGDVLRSVASTSGTETFSLDSRR LAEFDGVRKWIVVRINGTQVTYQPVIADNKGPQQPDPELNGVQNAYSNILNNYNNSGLTY VRGPVNVFTSNPSLQDREFGQAPVGSSFVQRRPAGFESIRYYLVPESAFNNKALQESDEM LRAKAVKSVATVVSAPVLEPGTVKATSFSRVIGSGATSTVAPKALDNVTYRVYAISRDQV GNETASATYDLVRFDNVGPTITGSVIRDTSDLPFPSQEPERCLSDIATISLGGIADNVGG VGLNPGQGLTFTLGGRQIQAGQFDTNQLADPEYTIGFNSLTDALGNPVVTAPTNAKVYID NTDPTVNFNRAVMQGTYASGGRVSVESDASDGGCGVYETRLFWDTANGVVDDATTTPAIG HPVQFARQRVTDGAKADSLNAGWNALQLPNGAGAVYLRSLVVDRAGNATISTTSIVVNAK ITNQARPLLGGFDAFKRNASAQFVGDDNVIAGVNGTAATPNVTGNSALDNILSLDSVGTL TTNAYLPRGATETAITEKIRNVGAYGRFDATQWNLIRDYQLNTDPTLRSAYVNAGNLANQ RGNNWRIRTPWVELGSSDTANTQQKFDFNSDLLNDFYYGRTFGNNHSVNLFSYDQFNGVV SDTAGAYSFYGETVRK
Sequence length 1036 AA
Subcellular LocationSurface (secreted)
Function The function(s) of bacterial S layers is still somewhat enigmatic. A primordial function of perpetual importance is shape maintenance and possibly shape determination.
Glycosylation Status
Technique(s) used for Glycosylation DetectionDetection of sugars by GC-MS technique after their conversion into alditol acetates.
Glycan Information
Glycan Annotation 6 tightly bound sugar residues per polypeptide chain.
Literature
Year of Identification1987
Year of Identification Month Wise1987.02
ReferencePeters, J., Peters, M., Lottspeich, F., Schafer, W. and Baumeister, W. (1987) Nucleotide sequence analysis of the gene encoding the Deinococcus radiodurans surface protein, derived amino acid sequence, and complementary protein chemical studies. J Bacteriol, 169, 5216-5223. [PubMed: 3667529]
AuthorPeters, J., Nitsch, M., Kuhlmorgen, B., Golbik, R., Lupas, A., Kellermann, J., Engelhardt, H., Pfander, J.P., Muller, S., Goldie, K
Research GroupMax Planck Institute for Biochemistry, Martinsried, Germany.
Corresponding Author Goldie, K
ContactMax Planck Institute for Biochemistry, Martinsried, Germany.