ProGP412

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP412
Validation Status Characterized
Organism Information
Organism NameBurkholderia thailandensis E264
Domain Bacteria
Classification Family: Burkholderiaceae
Order: Burkholderiales
Class: Betaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI) 271848
Genome Sequence(s)
GenBank NC_007650 and NC_007651
EMBL CP000086.1 and CP000085.1
Organism Additional Information Nonpathogenic
Gene Information
Gene NameFliC
GenBank Gene Sequence AF081500.1
Protein Information
Protein NameFliC (Flagellin)
UniProtKB/SwissProt ID O86045
NCBI RefSeq AAC31966.1
EMBL-CDSAAC31966.1
UniProtKB Sequence >tr|O86045|O86045_BURTH Flagellin OS=Burkholderia thailandensis GN=fliC PE=3 SV=1 MLGINSNLNSLVAQQNLNGSQSALSQAITRLSSGKRINSAADDAAGLAIATRMQTQINGL NQGVSNANDGVSILQTASSGLTSLTNSLQRIRQLAVQASNGPLSASDASALQQEVAQQIS EVNRIASQTNYNGKNILDGSAGTLSFQVGANVGQTVTVDLSQSMSAAKIGGGLVQTGQTL GTFKVAVDSSGAAWTASSTGQETTQINVLSDGKGGFTFTDQNNQTLSSTAVTALFGASTA GSGTALTVTLNSAATSSLSAADQAAAAAMQTQVNAVNQPQTVSNLNISTQTGAYQAMVSI DNALATVNNLQATLGAAQNRFTAIATTQQAGSNNLAQAQSQIQSADFAQETANLSRAQVL QQAGISVLAQANSLPQQVLKLLQ
Sequence length 383 AA
Subcellular LocationSecreted Flaggellin
Function Motility
Glycosylation Status
Glycosylation Type O (Ser) linked
Experimentally Validated Glycosite(s) in Full Length ProteinSer 197 or Ser198
Glycosite(s) Annotated Protein Sequence >tr|O86045|O86045_BURTH Flagellin OS=Burkholderia thailandensis GN=fliC PE=3 SV=1 MLGINSNLNSLVAQQNLNGSQSALSQAITRLSSGKRINSAADDAAGLAIATRMQTQINGL NQGVSNANDGVSILQTASSGLTSLTNSLQRIRQLAVQASNGPLSASDASALQQEVAQQIS EVNRIASQTNYNGKNILDGSAGTLSFQVGANVGQTVTVDLSQSMSAAKIGGGLVQTGQTL GTFKVAVDSSGAAWTAS*(197)S*(198)TGQETTQINVLSDGKGGFTFTDQNNQTLSSTAVTALFGASTA GSGTALTVTLNSAATSSLSAADQAAAAAMQTQVNAVNQPQTVSNLNISTQTGAYQAMVSI DNALATVNNLQATLGAAQNRFTAIATTQQAGSNNLAQAQSQIQSADFAQETANLSRAQVL QQAGISVLAQANSLPQQVLKLLQ
Sequence Around Glycosites (21 AA) VDSSGAAWTASSTGQETTQIN
DSSGAAWTASSTGQETTQINV
Glycosite Sequence Logo
Technique(s) used for Glycosylation Detectionbeta elimination of the Asp-N-digested peptide
Glycan Information
Glycan Annotation Glycan size identified to be 300 or 342 Da and predicted to be acetylated hexuronic acid.
Technique(s) used for Glycan Identification Trypsin deigestion and MS and MSMS
Literature
Year of Identification2011
Year of Identification Month Wise2011.07
Year of Validation 2011
ReferenceScott AE, Twine SM, Fulton KM, Titball RW, Essex-Lopresti AE, Atkins TP, Prior JL. (2011) Flagellar glycosylation in Burkholderia pseudomallei and Burkholderia thailandensis. J Bacteriol., 193, 3577-87. [PMID: 21602339]
AuthorScott AE, Twine SM, Fulton KM, Titball RW, Essex-Lopresti AE, Atkins TP, Prior JL
Research GroupDefence Science and Technology Laboratory, Porton Down, Salisbury SP4 0JQ, United Kingdom.
Corresponding Author Prior JL
ContactDefence Science and Technology Laboratory, Porton Down, Salisbury SP4 0JQ, United Kingdom.