ProGP415

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP415
Validation Status Uncharacterized
Organism Information
Organism NameFrancisella tularensis ssp. holarctica strain LVS
Domain Bacteria
Classification Family: Francisellaceae
Order: Thiotrichales
Class: Gammaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI) 376619
Genome Sequence(s)
GenBank NC_007880.1
EMBL AM233362.1
Organism Additional Information Named LVS for live vaccine strain
Gene Information
Gene NameFTL_1096
GenBank Gene Sequence NC_007880.1
Protein Information
Protein NameFTL_1096
UniProtKB/SwissProt ID Q19TM5
NCBI RefSeq WP_003019051.1
EMBL-CDSABE26691.1
UniProtKB Sequence >tr|Q19TM5|Q19TM5_FRATU Conserved lipoprotein OS=Francisella tularensis subsp. holarctica GN=CH66_691 PE=4 SV=1 MTKKKLLKALAVAAIATSLVACSDSSSNDKTSTTAVSSGSSVATTTVAAPADNTNVTANA SYTIGYGMGSSIATDKNIKTFNFNNDKVMAGFEDAINAKKPAIPLEDIANNMNTLRDKMQ QQMNQKAVTSFLSVQDGIYNSDLTPKSDIKNPDVVVYEFFDYQCMYCSKLAPEIEKIMKD NSDVQVVFAEFPIFGQKLPASEYAAEVSTAIYKLYGADAYVKYHNGIFATGEDEGSLKNA TVDNVAKQAGADMTKVNKAIQDDKIADHLKDMLKMGFGQLGIQGAPFLVIAPAKNATVAN TTIIGGYTTADGIQAAINKAKSTATTTSTSNNGQTDTKHSQNDIATVTAEAQAISGSTEQ LAQQSQDDDSVEA
Sequence length 373 AA
Subcellular LocationPeriplasmic space
Function DsbA homologue, involved in disulfide bond formation (through DsbA/DsbB system)
Protein Structure
Protein Additional InformationDsbA homologue
Glycosylation Status
Glycosylation Type O (Ser/Thr) linked
Glycosite Sequence Logo
Technique(s) used for Glycosylation Detection trypsin digestion and nLC-MS/MS
Glycan Information
Glycan Annotation Glycan has not been characterized but identified to be a hexasaccharide of 1156 Da
Literature
Year of Identification2011
Year of Identification Month Wise2011.11.1
ReferenceRebecca M. Thomas, Susan M. Twine, Kelly M. Fulton, Luc Tessier, Sara L. N. Kilmury, Wen Ding, Nicholas Harmer, Stephen L. Michell, Petra C. F. Oyston, Richard W. Titball and Joann L. Prior. (2011) Glycosylation of DsbA in Francisella tularensis subsp. tularensis.JOURNAL OF BACTERIOLOGY, Oct. 2011, p. 5498–5509
AuthorThomas RM1, Twine SM, Fulton KM, Tessier L, Kilmury SL, Ding W, Harmer N, Michell SL, Oyston PC, Titball RW, Prior JL.
Research GroupDefence Science and Technology Laboratory, Porton Down, Salisbury SP4 0JQ, United Kingdom.
Corresponding Author Prior JL
ContactDefence Science and Technology Laboratory, Porton Down, Salisbury SP4 0JQ, United Kingdom.