ProGP417

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP417
Validation Status Uncharacterized
Organism Information
Organism NameAcinetobacter baumannii ATCC 17978
Domain Bacteria
Classification Family: Moraxellaceae
Order: Pseudomonadales
Class: Gammaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI) 400667
Genome Sequence(s)
GenBank CP000521.1
EMBL CP018664.1
Organism Additional Information Human pathogen
Gene Information
Gene NameA1S_0556
GenBank Gene Sequence CP000521.1
Protein Information
Protein NamePutative Uncharacterized Protein
NCBI RefSeq ABO11009
EMBL-CDSABO11009.1
UniProtKB Sequence >ABO11009.2 hypothetical protein A1S_0556 [Acinetobacter baumannii ATCC 17978] MLTSKASLHLTLLASAIFLVACQPKSDPKESEDQQKPAVVEQKPVELTLKGETVPSKVTLPDCDGKTCPE FTVERLQSNFPFIDKIIDQQVLKALGQILEIAEPDAKAAQADKKTEASAAATTEQQDSFDAQVQRYANSF IDLDNELKALSSNHQINLLVKPKIIQSQGKVVTVVVNSSSYLGGAHGSAAQQYYNFDLKKEKQVKLEDLL RPEKKAALEKLAHEAFKAWVTDSKLANSVSEYEQAWPFKLTENFLLGDQGLILQYGEYEIGPYVVGLPRL VIPYDQLQEVLKEEYLPQPKAKPASTPAVKSAS
Sequence length 313 AA
Subcellular LocationMembrane
Function Unknown
Glycosylation Status
Glycosylation Type O- (Ser/Thr) linked
Technique(s) used for Glycosylation DetectionZIC HILIC and Mass spectrometry (LTQ-Orbitrap Velos)
Glycan Information
Glycan Annotation Pentasaccharide β-GlcNAc3NAcA4OAc-4-(β-GlcNAc-6-)-α-Gal-6-β-Glc-3-β-GalNAc-S/T. β-GlcNAc3NAcA4OAcA is an O-acetylated derivative of glucuronic acid.
Technique(s) used for Glycan Identification 1H:13C HSQC 2D NMR and mass spectrometry
Protein Glycosylation linked (PGL) gene(s)
OST Gene NamePglLAb
OST ProGT IDProGT56
Accessory Gene(s)Progt IDProGT56.1
Literature
Year of Identification2012
Year of Identification Month Wise2012.06.07
ReferenceIwashkiw JA, Seper A, Weber BS, Scott NE, Vinogradov E, Stratilo C, Reiz B, Cordwell SJ, Whittal R, Schild S, Feldman MF. (2012) Identification of a general O-linked protein glycosylation system in Acinetobacter baumannii and its role in virulence and biofilm formation. PLoS Pathog. 2012;8(6):e1002758. doi: 10.1371/journal.ppat.1002758. Epub 2012 Jun 7.
AuthorIwashkiw JA, Seper A, Weber BS, Scott NE, Vinogradov E, Stratilo C, Reiz B, Cordwell SJ, Whittal R, Schild S, Feldman MF.
Research GroupAlberta Glycomics Centre, Department of Biological Sciences, University of Alberta, Edmonton, Alberta, Canada
Corresponding Author Feldman MF.
ContactAlberta Glycomics Centre, Department of Biological Sciences, University of Alberta, Edmonton, Alberta, Canada