ProGP424 (Dipeptide ABC transporter, periplasmic d

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP424 (Dipeptide ABC transporter, periplasmic d
Validation Status Characterized
Organism Information
Organism NameSulfolobus solfataricus P2 (DSM 1617)
Domain Archaea
Classification Family: Sulfolobaceae
Order: Sulfolobales
Class: Thermoprotei or Crenarchaeota
Division or phylum: "Crenarchaeota"
Taxonomic ID (NCBI) 273057
Genome Information
GenBank AE006641
EMBL AE006641.1
Gene Information
Gene NameSSO2619
NCBI Gene ID 27428917
GenBank Gene Sequence NZ_LT549890.1
Protein Information
Protein NameDipeptide ABC transporter, periplasmic dipeptide binding protein (dppA)
UniProtKB/SwissProt ID Q97VK5
NCBI RefSeq WP_009989343.1
EMBL-CDSAAK42739.1
UniProtKB Sequence >tr|Q97VK5|Q97VK5_SULSO Dipeptide ABC transporter, periplasmic dipeptide binding protein (DppA) OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=dppA PE=4 SV=1 MSSLKGLALLSIMLIGIILPSLFLLQTSAQTSLTISPPNSSILIDVSQTAPPDALDPATG FYVQDGPLYQAIFQELVEFNGSNYLQVVPVIAQNWSTTNYENWTFFIRHGVYFPDGVQVN ASTVWFSFYRTILMGQGPGVANYIELLFNSTQYGQTGYALPWGVAAAIQNVTGLPTTKNA TLAANVLASILSHFNAANTTIQKIMEYPYQAVVVKGPYEVEINTLEPYRYFLLDIASWWG AIVNPVFIDEHGGVQPNTPNSYINDNGMEGTGPYVIKSVGPSLSEIVLVKNPHYWAANLS NIPLVAQPGHIPVIDIKYGLSHNNRVEDFATNQAQISYVSLPFLQQMYSAYQYNKYVSFN QIFANLGYEAAVFYIAMNTQIFPTNITAFRQAIVHAINYTAELDIFKFQNQTLAIEYLGP ISPVFPLYNEVMQLDKLHPYTYNLSLALHYLNEAGYEGHFYVVLPNGTTIGDTNGKQLGT LTIYALAPVNELEQEQLTIIQESLQKIGISTSIQYVLPSVTDNWITPSGTPALIDLGWFP DWPDPIFQELMAQTDVLYGGISGDLAWVNISTLQQIYENLPFLTNQTQQTLEVAKVYQIL YQQAPYAWLPNPVVYYFVQPYVKGFVYNPFIGYYYNLMYYQPYTITISTSTSTTSSTTTT TLQTTTTSIVFGGATNITTSVTSMTTTTSSSSSTLIYAVIGIVIVIIIIVVAVVLLRGRG RGGPGF
Sequence length 726 AA
Subcellular LocationTransmembrane
Function Peptide transporter activity
Glycosylation Status
Glycosylation Type N- (Asn) linked
Experimentally Validated Glycosite(s) in Full Length ProteinN120, N298 and N398
Glycosite(s) Annotated Protein Sequence >tr|Q97VK5|Q97VK5_SULSO Dipeptide ABC transporter, periplasmic dipeptide binding protein (DppA) OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=dppA PE=4 SV=1 MSSLKGLALLSIMLIGIILPSLFLLQTSAQTSLTISPPNSSILIDVSQTAPPDALDPATG FYVQDGPLYQAIFQELVEFNGSNYLQVVPVIAQNWSTTNYENWTFFIRHGVYFPDGVQVN*(120) ASTVWFSFYRTILMGQGPGVANYIELLFNSTQYGQTGYALPWGVAAAIQNVTGLPTTKNA TLAANVLASILSHFNAANTTIQKIMEYPYQAVVVKGPYEVEINTLEPYRYFLLDIASWWG AIVNPVFIDEHGGVQPNTPNSYINDNGMEGTGPYVIKSVGPSLSEIVLVKNPHYWAAN*(298)LS NIPLVAQPGHIPVIDIKYGLSHNNRVEDFATNQAQISYVSLPFLQQMYSAYQYNKYVSFN QIFANLGYEAAVFYIAMNTQIFPTNITAFRQAIVHAIN*(398)YTAELDIFKFQNQTLAIEYLGP ISPVFPLYNEVMQLDKLHPYTYNLSLALHYLNEAGYEGHFYVVLPNGTTIGDTNGKQLGT LTIYALAPVNELEQEQLTIIQESLQKIGISTSIQYVLPSVTDNWITPSGTPALIDLGWFP DWPDPIFQELMAQTDVLYGGISGDLAWVNISTLQQIYENLPFLTNQTQQTLEVAKVYQIL YQQAPYAWLPNPVVYYFVQPYVKGFVYNPFIGYYYNLMYYQPYTITISTSTSTTSSTTTT TLQTTTTSIVFGGATNITTSVTSMTTTTSSSSSTLIYAVIGIVIVIIIIVVAVVLLRGRG RGGPGF
Sequence Around Glycosites (21 AA) GVYFPDGVQVNASTVWFSFYR
LVKNPHYWAANLSNIPLVAQP
AFRQAIVHAINYTAELDIFKF
ProGP Web Logo
Technique(s) used for Glycosylation DetectionConcanavalin A lectin affinity chromatography
Glycan Information
Glycan Annotation Branched sulfated heptasaccharide, Hex4(GlcNAc)2 plus sulfoquinovose where Hex is D-mannose and D-glucose.
Literature
Year of Identification2013
Year of Identification Month Wise2013.6.1
Year of Validation 2013