ProGP425

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP425
Validation Status Characterized
Organism Information
Organism NameAeromonas hydrophila AH-3 (serotype O34)
Domain Bacteria
Classification Family: Aeromonadaceae
Order: Aeromonadales
Class: Gammaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI) 644
Gene Information
Gene NameflaB
Protein Information
Protein NameFlaB (Polar flagellin)
Function FlaB is one of the two monomers of polar flagellin which is constitutively expressed.
Glycosylation Status
Glycosylation Type O (Thr) linked
Experimentally Validated Glycosite(s) in Full Length ProteinT161
Glycosite(s) Annotated Protein Sequence >tr|Q2N2Q5|Q2N2Q5_AERHY Flagellin OS=Aeromonas hydrophila GN=flaB PE=3 SV=1 MAMYINTNTSSLNAQRNLMNTNKSLDTSYTRLASGLRINTAKDDAAGLQISNRLTSQVNG LDQGNRNANDGISVAQTAEGAMDEVTSMLQRMRTLAQQSANGSNNTDDRTALQQEFDQLT TEINRISSDTSFGGQKLLDGNYKGSFQVGADAGQTITFKMT*(161)SAFTISGIASSTKGSATVA TSASGEPYTVTKGTTAVTSTSVSSIKAASSAQLAMANLDFMIKAVDSKRAELGAVQNRFD STIRNQSNVSENLSAARSRIRDADFATETANLTKQNILQQAASSILAQANQRPQSALSLL G
Sequence Around Glycosites (21 AA) DAGQTITFKMTSAFTISGIAS 
Glycosite Sequence Logo
Protein Glycosylation- Implication O-Glycosylation is necessary for flagellar biogenesis. Pseudaminic acid biosynthetic genes pseB and pseF homologues, were found to be required for flagellar formation and flagellin expression.
Glycan Information
Glycan Annotation A heptasaccharide with sequence 376 Da-Hex-Hex-HexNAc- HexNAc-HexNAc-102 Da, comprised of three N-acetylhexoasmines (with variable addition of 0–2 phosphate groups and 0–2 methyl groups on each), two hexoses and two unknown monosaccharides of 376 and 102 Da. The 376 Da residue is pseudaminic acid (Pse5Ac7Ac) modified by the addition of an acetyl group and water. The number of heptasaccharide chains may vary from one to six, reflecting glycan heterogeneity.
Literature
Year of Identification2012
Year of Identification Month Wise2012.8.10
Year of Validation 2012
ReferenceWilhelms M, Fulton KM, Twine SM, Tomás JM, Merino S. (2012) Differential glycosylation of polar and lateral flagellins in Aeromonas hydrophila AH-3. J Biol Chem. 287(33):27851-62. [PMID: 22733809]
AuthorWilhelms M, Fulton KM, Twine SM, Tomás JM, Merino S
Research GroupDepartamento de Microbiología, Facultad de Biología, Universidad de Barcelona, Diagonal 645, 08071 Barcelona, Spain
Corresponding Author Merino S
ContactDepartamento de Microbiología, Facultad de Biología, Universidad de Barcelona, Diagonal 645, 08071 Barcelona, Spain