ProGP426

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP426
Validation Status Characterized
Organism Information
Organism NameAeromonas hydrophila AH-3 (serotype O34)
Domain Bacteria
Classification Family: Aeromonadaceae
Order: Aeromonadales
Class: Gammaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI) 644
Gene Information
Gene NamelafA
Protein Information
Protein NameLafA (Lateral flagellin)
Function Lateral flagellin is inducible.
Glycosylation Status
Glycosylation Type O (Ser) linked
Experimentally Validated Glycosite(s) in Full Length ProteinS178
Glycosite(s) Annotated Protein Sequence >tr|Q9AET1|Q9AET1_AERHY Flagellin OS=Aeromonas hydrophila GN=lafA PE=3 SV=1 MGLSIHTNFASMTTQNQLNSTNKMLGTAMQRLGTGLRINSAADDAAGLQIATRLQAQSNG QKVGMRNAQDAISMIQTAESAMDEMTNITQRMKDLATQAANGTNSTKDLDAMDAEFKELG KELGNIRDNTTFGGTSLLKTGGKFQATGGVTFQIGASVDEKLVFDASTKVTSVNTAIS*(178)TA SAAALTTGAAAQITAMDSMLEKIGEARSAFGANINRLEHTVNNLSNMKENTDMANGRIMD ADFAQESTNMTKNQMLMQAGMSVLSNSNQMTGMVTGLLR
Sequence Around Glycosites (21 AA) TKVTSVNTAISTASAAALTTG 
Glycosite Sequence Logo
Protein Glycosylation- Implication O-Glycosylation is necessary for flagellar biogenesis. Pseudaminic acid biosynthetic genes pseB and pseF homologues, were found to be required for flagellar formation and flagellin expression.
Glycan Information
Glycan Annotation A 376 Da monosaccharide which is pseudaminic acid (Pse5Ac7Ac) modified by the addition of an acetyl group and water. This sugar was detected at three sites in the protein sequence.
Literature
Year of Identification2012
Year of Identification Month Wise2012.8.10
Year of Validation 2012
ReferenceWilhelms M, Fulton KM, Twine SM, Tomás JM, Merino S. (2012) Differential glycosylation of polar and lateral flagellins in Aeromonas hydrophila AH-3. J Biol Chem. 287(33):27851-62. [PMID: 22733809]
AuthorWilhelms M, Fulton KM, Twine SM, Tomás JM, Merino S
Research GroupDepartamento de Microbiología, Facultad de Biología, Universidad de Barcelona, Diagonal 645, 08071 Barcelona, Spain
Corresponding Author Merino S
ContactDepartamento de Microbiología, Facultad de Biología, Universidad de Barcelona, Diagonal 645, 08071 Barcelona, Spain