ProGP428

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP428
Validation Status Characterized
Organism Information
Organism NameSulfolobus solfataricus P2 (DSM 1617)
Domain Archaea
Classification Family: Sulfolobaceae
Order: Sulfolobales
Class: Thermoprotei or Crenarchaeota
Division or phylum: "Crenarchaeota"
Taxonomic ID (NCBI) 273057
Genome Sequence(s)
GenBank AE006641
EMBL AE006641.1
Gene Information
Gene NameSSO2619
NCBI Gene ID 27428917
GenBank Gene Sequence NZ_LT549890.1
Protein Information
Protein NameDipeptide ABC transporter, periplasmic dipeptide binding protein (dppA)
UniProtKB/SwissProt ID Q97VK5
NCBI RefSeq WP_009989343.1
EMBL-CDSAAK42739.1
UniProtKB Sequence >tr|Q97VK5|Q97VK5_SULSO Dipeptide ABC transporter, periplasmic dipeptide binding protein (DppA) OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=dppA PE=4 SV=1 MSSLKGLALLSIMLIGIILPSLFLLQTSAQTSLTISPPNSSILIDVSQTAPPDALDPATG FYVQDGPLYQAIFQELVEFNGSNYLQVVPVIAQNWSTTNYENWTFFIRHGVYFPDGVQVN ASTVWFSFYRTILMGQGPGVANYIELLFNSTQYGQTGYALPWGVAAAIQNVTGLPTTKNA TLAANVLASILSHFNAANTTIQKIMEYPYQAVVVKGPYEVEINTLEPYRYFLLDIASWWG AIVNPVFIDEHGGVQPNTPNSYINDNGMEGTGPYVIKSVGPSLSEIVLVKNPHYWAANLS NIPLVAQPGHIPVIDIKYGLSHNNRVEDFATNQAQISYVSLPFLQQMYSAYQYNKYVSFN QIFANLGYEAAVFYIAMNTQIFPTNITAFRQAIVHAINYTAELDIFKFQNQTLAIEYLGP ISPVFPLYNEVMQLDKLHPYTYNLSLALHYLNEAGYEGHFYVVLPNGTTIGDTNGKQLGT LTIYALAPVNELEQEQLTIIQESLQKIGISTSIQYVLPSVTDNWITPSGTPALIDLGWFP DWPDPIFQELMAQTDVLYGGISGDLAWVNISTLQQIYENLPFLTNQTQQTLEVAKVYQIL YQQAPYAWLPNPVVYYFVQPYVKGFVYNPFIGYYYNLMYYQPYTITISTSTSTTSSTTTT TLQTTTTSIVFGGATNITTSVTSMTTTTSSSSSTLIYAVIGIVIVIIIIVVAVVLLRGRG RGGPGF
Sequence length 726 AA
Subcellular LocationTransmembrane
Function peptide transporter activity
Glycosylation Status
Glycosylation Type N (Asn) linked
Experimentally Validated Glycosite(s) in Full Length ProteinN120, N298 and N398
Glycosite(s) Annotated Protein Sequence >tr|Q97VK5|Q97VK5_SULSO Dipeptide ABC transporter, periplasmic dipeptide binding protein (DppA) OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=dppA PE=4 SV=1 MSSLKGLALLSIMLIGIILPSLFLLQTSAQTSLTISPPNSSILIDVSQTAPPDALDPATG FYVQDGPLYQAIFQELVEFNGSNYLQVVPVIAQNWSTTNYENWTFFIRHGVYFPDGVQVN*(120) ASTVWFSFYRTILMGQGPGVANYIELLFNSTQYGQTGYALPWGVAAAIQNVTGLPTTKNA TLAANVLASILSHFNAANTTIQKIMEYPYQAVVVKGPYEVEINTLEPYRYFLLDIASWWG AIVNPVFIDEHGGVQPNTPNSYINDNGMEGTGPYVIKSVGPSLSEIVLVKNPHYWAAN*(298)LS NIPLVAQPGHIPVIDIKYGLSHNNRVEDFATNQAQISYVSLPFLQQMYSAYQYNKYVSFN QIFANLGYEAAVFYIAMNTQIFPTNITAFRQAIVHAIN*(398)YTAELDIFKFQNQTLAIEYLGP ISPVFPLYNEVMQLDKLHPYTYNLSLALHYLNEAGYEGHFYVVLPNGTTIGDTNGKQLGT LTIYALAPVNELEQEQLTIIQESLQKIGISTSIQYVLPSVTDNWITPSGTPALIDLGWFP DWPDPIFQELMAQTDVLYGGISGDLAWVNISTLQQIYENLPFLTNQTQQTLEVAKVYQIL YQQAPYAWLPNPVVYYFVQPYVKGFVYNPFIGYYYNLMYYQPYTITISTSTSTTSSTTTT TLQTTTTSIVFGGATNITTSVTSMTTTTSSSSSTLIYAVIGIVIVIIIIVVAVVLLRGRG RGGPGF
Sequence Around Glycosites (21 AA) GVYFPDGVQVNASTVWFSFYR
LVKNPHYWAANLSNIPLVAQP
AFRQAIVHAINYTAELDIFKF
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionConcanavalin A lectin affinity chromatography
Glycan Information
Glycan Annotation Branched sulfated heptasaccharide, Hex4(GlcNAc)2 plus sulfoquinovose where Hex is D-mannose and D-glucose.
Literature
Additional CommentThe glycan structure is by far the most complex one known in archaea till now.
Year of Identification2013
Year of Identification Month Wise2013.6.1
Year of Validation 2013
ReferenceGianna Palmieri, Marco Balestrieri, Jasna Peter-Katalinić, Gottfried Pohlentz, Mosè Rossi, Immacolata Fiume, and Gabriella Pocsfalvi (2013) Surface-exposed glycoproteins of hyperthermophilic Sulfolobus solfataricus P2 show a common N-glycosylation profile. J. Proteome Res., 12, 2779−2790.
AuthorGianna Palmieri, Marco Balestrieri, Jasna Peter-Katalinić, Gottfried Pohlentz, Mosè Rossi, Immacolata Fiume, and Gabriella Pocsfalvi
Research GroupInstitute of Protein Biochemistry, National Research Council of Italy, Napoli, Italy.
Corresponding Author Gabriella Pocsfalvi
ContactInstitute of Protein Biochemistry, National Research Council of Italy, Napoli, Italy.