ProGP429

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP429
Validation Status Characterized
Organism Information
Organism NameSulfolobus solfataricus P2 (DSM 1617)
Domain Archaea
Classification Family: Sulfolobaceae
Order: Sulfolobales
Class: Thermoprotei or Crenarchaeota
Division or phylum: "Crenarchaeota"
Taxonomic ID (NCBI) 273057
Genome Sequence(s)
GenBank AE006641
EMBL AE006641.1
Gene Information
Gene NameSSO0999
NCBI Gene ID 27427317
GenBank Gene Sequence NZ_LT549890.1
Protein Information
Protein NameABC Transporter (TreS)
UniProtKB/SwissProt ID Q97ZC3
NCBI RefSeq WP_009989239.1
EMBL-CDSAAK41270.1
UniProtKB Sequence >tr|Q97ZC3|Q97ZC3_SULSO ABC Transporter OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=SSO0999 PE=4 SV=1 MSRSDKFSNKEKMRRGLSTTTIIGIVVAIVIIVIGAVAAVTLLSHKPSQVVSTTSPSTSQ SATSTSPSQVITITYFDDLSPSEANITQKIIIPQFEATHPNIKINYVDESADDIVKSVVE LVKSGNVGPVIIGEDNLVIGELLNGNYLMNLTPYVNQILQNVSLIPSMQSLVQYEQKVYH GTYFIPLRANIPLVWYNASLFRQLGLASPPENWSQLLQYAKIIYDKTGVKPIMFQGHGGA STYTELYQWMVQAGGNPFLFNDSGDVLAFEYLYNLSQYFNLEYIHGYWGSYKGLIDGSYY LIDYQWPYIYSVMASEGVNMSNIGFYPGPTGPVNGDHLVGGDVLAIPKGATHIDALIEFA KFLLSPQVQREFIIYLSWPAVNQQAYQNLPSNISSLYKAEEEALQNAFFREPVPWITVWG QIADNVFNQIIVNHAPYSQIPQILSQANKEMYQYLLQNYNVTVAQEYEEGVFGPLYG
Sequence length 477 AA
Subcellular LocationIntegral component of membrane
Function Sugar ABC transporter substrate-binding protein.
Glycosylation Status
Glycosylation Type N- (Asn) linked
Experimentally Validated Glycosite(s) in Full Length ProteinN212 and N197
Glycosite(s) Annotated Protein Sequence >tr|Q97ZC3|Q97ZC3_SULSO ABC Transporter OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=SSO0999 PE=4 SV=1 MSRSDKFSNKEKMRRGLSTTTIIGIVVAIVIIVIGAVAAVTLLSHKPSQVVSTTSPSTSQ SATSTSPSQVITITYFDDLSPSEANITQKIIIPQFEATHPNIKINYVDESADDIVKSVVE LVKSGNVGPVIIGEDNLVIGELLNGNYLMNLTPYVNQILQNVSLIPSMQSLVQYEQKVYH GTYFIPLRANIPLVWYN*(197)ASLFRQLGLASPPEN*(212)WSQLLQYAKIIYDKTGVKPIMFQGHGGA STYTELYQWMVQAGGNPFLFNDSGDVLAFEYLYNLSQYFNLEYIHGYWGSYKGLIDGSYY LIDYQWPYIYSVMASEGVNMSNIGFYPGPTGPVNGDHLVGGDVLAIPKGATHIDALIEFA KFLLSPQVQREFIIYLSWPAVNQQAYQNLPSNISSLYKAEEEALQNAFFREPVPWITVWG QIADNVFNQIIVNHAPYSQIPQILSQANKEMYQYLLQNYNVTVAQEYEEGVFGPLYG
Sequence Around Glycosites (21 AA) LRANIPLVWYNASLFRQLGLA
RQLGLASPPENWSQLLQYAKI
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionConcanavalin A lectin affinity chromatography
Glycan Information
Glycan Annotation Branched sulfated heptasaccharide, Hex4(GlcNAc)2 plus sulfoquinovose where Hex is D-mannose and D-glucose.
Literature
Year of Identification2013
Year of Identification Month Wise2013.6.1
Year of Validation 2013
ReferenceGianna Palmieri, Marco Balestrieri, Jasna Peter-Katalinic?, Gottfried Pohlentz, Mose? Rossi, Immacolata Fiume, and Gabriella Pocsfalvi (2013) Surface-exposed glycoproteins of hyperthermophilic Sulfolobus solfataricus P2 show a common N-glycosylation profile. J. Proteome Res., 12, 2779?2790.
AuthorGianna Palmieri, Marco Balestrieri, Jasna Peter-Katalinic?, Gottfried Pohlentz, Mose? Rossi, Immacolata Fiume, and Gabriella Pocsfalvi
Research GroupInstitute of Protein Biochemistry, National Research Council of Italy, Napoli, Italy.
Corresponding Author Gabriella Pocsfalvi
ContactInstitute of Protein Biochemistry, National Research Council of Italy, Napoli, Italy.