ProGP43

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP43
Validation Status Characterized
Organism Information
Organism NameMethanothermus fervidus strain V24S (DSM 2088)
Domain Archaea
Classification Family: Methanothermaceae
Order: Methanobacteriales
Class: Methanobacteria or Archaeobacteria
Division or phylum: "Euryarchaeota"
Taxonomic ID (NCBI) 2180
Genome Sequence(s)
EMBL X58297
Gene Information
Gene NameslgA
Protein Information
Protein NameSlgA (cell surface glycoprotein)
UniProtKB/SwissProt ID P27373
EMBL-CDSCAA41230.1
UniProtKB Sequence >sp|P27373|CSG_METFE Cell surface glycoprotein OS=Methanothermus fervidus GN=slgA PE=1 SV=1 MRKFTLLMLLLIVISMSGIAGAAEVKNLNTSKTFTKIQEAIDDPSTTDGNIIIVGPGNYT ENILVNKSLTLKSNGSAIINAVSSEKSTITIKANNVWIEGFIIIGGKNGIYMENVTGCTI TNNTIQNAFVSGWEYYGGNGICLVNSTNNTITNNIIRNNTWNGINVCESKGNIIKNNTIM YSGGIGIYVWGFNKFEGNNIIENNRIINATYGGIYLFRPSNNKICRNYIANVSSGGGGMS GAICIDVSDYNIVKDNIGINCDGGLFTDGMIGNEITNNIFKNCKVAVSESTYGPASRNNK IYGNYFINYETAISDPKGELVDNIWNTTEGGNYWSNYTGNNTGDGTGNIPYYYDNKPLVV DLAIEDIAAKPSGIEVRVKNLGKADIKKIDPLTKLKIKISCDNDVYETFIDPLSAGESQI VRWDKIVPEGNHTIKAEIPYSAEGYLIGTNIRDADISNNVFSKIVQGFVQNKTFTITLTN LGKSTITIKYYISIYTNPVNGTKVSYRELTITLKPNETKTIELGKYPFKYAVSGTMIVKN PSRYRIPLNLRIKYEIEGLNPQMREISKYIAPRGEFRYIARYTGKEEGYADVW
Sequence length 593 AA
Subcellular LocationSurface
Function In Archaea, which do not possess other cell wall components, the S-layer has to maintain the cell integrity and stabilize as well as to protect the cell against mechanical and osmotic stresses or extreme pH conditions. It is also predicted that the S-layer has to maintain or even determine the cell shape.
Glycosylation Status
Glycosylation Type N (Asn) linked
Experimentally Validated Glycosite(s) in Full Length Protein(Signal peptide: 1-22) N29 in case of precursor protein.
Experimentally Validated Glycosite(s ) in Mature ProteinN7
Glycosite(s) Annotated Protein Sequence >sp|P27373|CSG_METFE Cell surface glycoprotein OS=Methanothermus fervidus GN=slgA PE=1 SV=1 MRKFTLLMLLLIVISMSGIAGAAEVKNLN*(29)TSKTFTKIQEAIDDPSTTDGNIIIVGPGNYT ENILVNKSLTLKSNGSAIINAVSSEKSTITIKANNVWIEGFIIIGGKNGIYMENVTGCTI TNNTIQNAFVSGWEYYGGNGICLVNSTNNTITNNIIRNNTWNGINVCESKGNIIKNNTIM YSGGIGIYVWGFNKFEGNNIIENNRIINATYGGIYLFRPSNNKICRNYIANVSSGGGGMS GAICIDVSDYNIVKDNIGINCDGGLFTDGMIGNEITNNIFKNCKVAVSESTYGPASRNNK IYGNYFINYETAISDPKGELVDNIWNTTEGGNYWSNYTGNNTGDGTGNIPYYYDNKPLVV DLAIEDIAAKPSGIEVRVKNLGKADIKKIDPLTKLKIKISCDNDVYETFIDPLSAGESQI VRWDKIVPEGNHTIKAEIPYSAEGYLIGTNIRDADISNNVFSKIVQGFVQNKTFTITLTN LGKSTITIKYYISIYTNPVNGTKVSYRELTITLKPNETKTIELGKYPFKYAVSGTMIVKN PSRYRIPLNLRIKYEIEGLNPQMREISKYIAPRGEFRYIARYTGKEEGYADVW
Sequence Around Glycosites (21 AA) IAGAAEVKNLNTSKTFTKIQE
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionCarbohydrate detection (TLC, thin layer chromatography)
Technique(s) used for Glycosylated Residue(s) Detection Edman degradation
Glycan Information
Glycan Annotation Linkage: β-GlcNAc-Asn.
N-linked heterosaccharide is 17 % of molecular weight of the protein. Composition of the hexasaccharide (1061.83 Da) is α-D-3-O-MetManp-(1→6)-α-D-3-O-MetManp-[(1→2)-α-D-Manp]3-(1→4)-D-GalNAc.
3-O-methylglucose, N-acetylglucosamine, and galactose are also found in lesser amounts. 3-O-methylmannose could be partly replaced by 3-O-methylglucose.
3-O-methylmannose and 3-O-methylglucose are present in the intact glycoprotein in a molar ratio of 7:1.
Technique(s) used for Glycan Identification Methylation analysis, plasma desorption mass spectrometry, and high field 1H, 13C NMR spectroscopy- COSY (correlated spectroscopy), 1D-, 2D-TOCSY (total correlation spectroscopy), and HMBC (heteronuclear multiple bond coherence), HMQC (heteronuclear multiple quantum correlation).
Protein Glycosylation linked (PGL) gene(s)
OST Gene NameOligosaccharyl transferase stt3 subunit
Literature
Year of Identification1989
Year of Identification Month Wise1989.02.05
Year of Validation 1991
Reference Brockl, G., Behr, M., Fabry, S., Hensel, R., Kaudewitz, H., Biendl, E. and Konig, H. (1991) Analysis and nucleotide sequence of the genes encoding the surface-layer glycoproteins of the hyperthermophilic methanogens Methanothermus fervidus and Methanothermus sociabilis. Eur J Biochem, 199, 147-152. [PubMed: 1712296]
Author Konig, H.
Research GroupAbteilung für Angewandte Mikrobiologie, Universität Ulm, Federal Republic of Germany
Corresponding Author Brockl, G., Behr, M., Fabry, S., Hensel, R., Kaudewitz, H., Biendl, E. Konig, H.
ContactAbteilung für Angewandte Mikrobiologie, Universität Ulm, Federal Republic of Germany
Reference1) Karcher, U., Schroder, H., Haslinger, E., Allmaier, G., Schreiner, R., Wieland, F., Haselbeck, A. and Konig, H. (1993) Primary structure of the heterosaccharide of the surface glycoprotein of Methanothermus fervidus. J Biol Chem, 268, 26821-26826. [PubMed: 8262914]
Author Karcher, U., Schroder, H., Haslinger, E., Allmaier, G., Schreiner, R., Wieland, F., Haselbeck, A. and Konig, H.
Research GroupAbteilung Angewandte Mikrobiologie und Mykologie, Universität Ulm, Germany.
Corresponding Author Konig, H.
ContactAbteilung Angewandte Mikrobiologie und Mykologie, Universität Ulm, Germany.
Reference Hartmann, E. and König, H. (1989) Uridine and dolichyl diphosphate activated oligosaccharides are intermediates in the biosynthesis of the S-layer glycoprotein of Methanothermus fervidus. Arch Microbiol, 151, 274-281.
Author Hartmann, E. König, H.
Research GroupAngewandte MikrobiologieUniversität UlmUlmFederal Republic of Germany
Corresponding Author König, H.
ContactAngewandte MikrobiologieUniversität UlmUlmFederal Republic of Germany
Reference Kalmokoff, M.L., Koval, S.F. and Jarrell, K.F. (1992) Relatedness of the flagellins from methanogens. Arch Microbiol, 157, 481-487. [PubMed: 1503530]
Author Kalmokoff, M.L., Koval, S.F. Jarrell, K.F.
Research GroupDepartment of Microbiology and Immunology, Queen's University, Kingston, Ontario, Canada.
Corresponding Author Jarrell, K.F.
ContactDepartment of Microbiology and Immunology, Queen's University, Kingston, Ontario, Canada.
Reference Kalmokoff, M.L., Koval, S.F. and Jarrell, K.F. (1992) Relatedness of the flagellins from methanogens. Arch Microbiol, 157, 481-487. [PubMed: 1503530]
AuthorKalmokoff, M.L., Koval, S.F. and Jarrell, K.F.
Research GroupDepartment of Microbiology and Immunology, Queen's University, Kingston, Ontario, Canada.
Corresponding Author Jarrell, K.F.
ContactDepartment of Microbiology and Immunology, Queen's University, Kingston, Ontario, Canada.