ProGP430

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP430
Validation Status Characterized
Organism Information
Organism NameSulfolobus solfataricus P2 (DSM 1617)
Domain Archaea
Classification Family: Sulfolobaceae
Order: Sulfolobales
Class: Thermoprotei or Crenarchaeota
Division or phylum: "Crenarchaeota"
Taxonomic ID (NCBI) 273057
Genome Sequence(s)
GenBank AE006641
EMBL AE006641.1
Gene Information
Gene NameSSO1273
NCBI Gene ID 25404710
GenBank Gene Sequence NZ_CP011056.1
Protein Information
Protein NameOligopeptide binding protein
UniProtKB/SwissProt ID Q97YQ1
NCBI RefSeq WP_010923279.1
EMBL-CDSAAK41510.1
UniProtKB Sequence >tr|Q97YQ1|Q97YQ1_SULSO Uncharacterized protein OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=SSO1273 PE=4 SV=1 MYSVLSIKDKKIISLLILVATAISPIFAIAQSASSSPASTAITIISYNGNDANGILAFEH GQIAFYAYAVPPSEYTSLPPGAKAYLLPNTYYDILVNPLNTTFGFNPFQFQEVRFALNYI VNRTYFVDSILHGYGIPTISLYAGEPDVIHLQQTLSKYANVHYNFTYANETIYKVLTAHG AKYINGQWYYNGKPITVYVFVRTDATVRREYAQYFITQLQKLGFTVQQIQGNLQKEISVV YGSDPANTTWNILIEAWGGTYGYYDSSLAVGLYSTLGASDPFSSYYGLSMGTYNDTRYES SLLLKEANELDNLSLIIAQSQFTSAQEYYQIYNKIVELGINMSVRIGLGMSLTPIYALSN INGVYPSFAQSTLLSFQTYYSITNGSYPNVTIGVRYLSQGSANPGAGFTDSYTDEIGNAL FTPSSLTVPGSGYPVPFIYTYKIVNITPHAVVSVPSNALWWNPTTQQITKVSPNTTAQMA VIYNLAPLFNNDKWADGQNITLADIIYEYIVASEMSLNSSNPIYDSTASSVYAPALQTIK GFKIINSSAIEIWGNDWFFDPTEAVVSLFGSFNPLGYALAGGGYFPWQMYVGMKDVVAQG KAAWSEGAAQSKGIDWLNLVSPTDIGYITSALQNASATGYIPKSLQIVENLSGITLVTPQ EAKAGYEAAINFMKTYGNGLIGDGPYILVAWNPSASPPYAKLIRNPYFHLVPPSNALALP TMYSVSLSIPSTVSPGQTLTGTVMGTPAGSTTAIPTPNAVVNIELLYPNGSIISGYQLMT NSSGQFTFTVPSSLSPGSYLLSVSAYSNTSILINPVTYTLVVLPSITTTTSTTTSTTTTT STTTTTSVSTSLSTTTITSVSTVISTVVSTIVSTVVSSASNIGYIAVIVVLIIIIIALAV LLFRRR
Sequence length 906 AA
Subcellular LocationOuter membrane bound
Function Highly selective oligopeptide binding component of an ABC transporter system.
Glycosylation Status
Glycosylation Type N (Asn) linked
Experimentally Validated Glycosite(s) in Full Length ProteinN100, N122, N164, N169, N247, N294, N312, N341, N384, N389, N445, N474, N499, N518, N546, N634, N650, N569, N781 and N808
Glycosite(s) Annotated Protein Sequence >tr|Q97YQ1|Q97YQ1_SULSO Uncharacterized protein OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=SSO1273 PE=4 SV=1 MYSVLSIKDKKIISLLILVATAISPIFAIAQSASSSPASTAITIISYNGNDANGILAFEH GQIAFYAYAVPPSEYTSLPPGAKAYLLPNTYYDILVNPLN*(100)TTFGFNPFQFQEVRFALNYI VN*(122)RTYFVDSILHGYGIPTISLYAGEPDVIHLQQTLSKYANVHYN*(164)FTYAN*(169)ETIYKVLTAHG AKYINGQWYYNGKPITVYVFVRTDATVRREYAQYFITQLQKLGFTVQQIQGNLQKEISVV YGSDPAN*(247)TTWNILIEAWGGTYGYYDSSLAVGLYSTLGASDPFSSYYGLSMGTYN*(294)DTRYES SLLLKEANELDN*(312)LSLIIAQSQFTSAQEYYQIYNKIVELGIN*(341)MSVRIGLGMSLTPIYALSN INGVYPSFAQSTLLSFQTYYSITN*(389)GSYPNVTIGVRYLSQGSANPGAGFTDSYTDEIGNAL FTPSSLTVPGSGYPVPFIYTYKIVN*(445)ITPHAVVSVPSNALWWNPTTQQITKVSPN*(474)TTAQMA VIYNLAPLFNNDKWADGQN*(499)ITLADIIYEYIVASEMSLN*(518)SSNPIYDSTASSVYAPALQTIK GFKIIN*(546)SSAIEIWGNDWFFDPTEAVVSLFGSFN*(569)PLGYALAGGGYFPWQMYVGMKDVVAQG KAAWSEGAAQSKGIDWLNLVSPTDIGYITSALQN*(634)ASATGYIPKSLQIVEN*(650)LSGITLVTPQ EAKAGYEAAINFMKTYGNGLIGDGPYILVAWNPSASPPYAKLIRNPYFHLVPPSNALALP TMYSVSLSIPSTVSPGQTLTGTVMGTPAGSTTAIPTPNAVVNIELLYPNGSIISGYQLMT N*(781)SSGQFTFTVPSSLSPGSYLLSVSAYSN*(808)TSILINPVTYTLVVLPSITTTTSTTTSTTTTT STTTTTSVSTSLSTTTITSVSTVISTVVSTIVSTVVSSASNIGYIAVIVVLIIIIIALAV LLFRRR
Sequence Around Glycosites (21 AA) TYYDILVNPLNTTFGFNPFQF
EVRFALNYIVNRTYFVDSILH
TLSKYANVHYNFTYANETIYK
ANVHYNFTYANETIYKVLTAH
ISVVYGSDPANTTWNILIEAW
SYYGLSMGTYNDTRYESSLLL
LLLKEANELDNLSLIIAQSQF
IYNKIVELGINMSVRIGLGMS
VPFIYTYKIVNITPHAVVSVP
TTQQITKVSPNTTAQMAVIYN
FNNDKWADGQNITLADIIYEY
EYIVASEMSLNSSNPIYDSTA
LQTIKGFKIINSSAIEIWGND
EAVVSLFGSFNPLGYALAGGG
DIGYITSALQNASATGYIPKS YIPKSLQIVENLSGITLVTPQ
SIISGYQLMTNSSGQFTFTVP
SYLLSVSAYSNTSILINPVTY
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionConcanavalin A lectin affinity chromatography
Glycan Information
Glycan Annotation Branched sulfated heptasaccharide, Hex4(GlcNAc)2 plus sulfoquinovose where Hex is D-mannose and D-glucose.
Technique(s) used for Glycan Identification HILIC-ESI−MS, HPAEC-PAD (High performance anion exchange chromatography with pulsed amperiometric detection), RP nano-HPLC−ESI−MS/MS and nano-ESI−MS/MS analyses
Literature
Additional CommentThe glycan structure is by far the most complex one known in archaea till now.
Year of Identification2013
Year of Identification Month Wise2013.6.1
Year of Validation 2013
ReferenceGianna Palmieri, Marco Balestrieri, Jasna Peter-Katalinić, Gottfried Pohlentz, Mosè Rossi, Immacolata Fiume, and Gabriella Pocsfalvi (2013) Surface-exposed glycoproteins of hyperthermophilic Sulfolobus solfataricus P2 show a common N-glycosylation profile. J. Proteome Res., 12, 2779−2790.
AuthorGianna Palmieri, Marco Balestrieri, Jasna Peter-Katalinić, Gottfried Pohlentz, Mosè Rossi, Immacolata Fiume, and Gabriella Pocsfalvi
Research GroupInstitute of Protein Biochemistry, National Research Council of Italy, Napoli, Italy.
Corresponding Author Gabriella Pocsfalvi
ContactInstitute of Protein Biochemistry, National Research Council of Italy, Napoli, Italy.