ProGP433

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP433
Validation Status Characterized
Organism Information
Organism NameSulfolobus solfataricus P2 (DSM 1617)
Domain Archaea
Classification Family: Sulfolobaceae
Order: Sulfolobales
Class: Thermoprotei or Crenarchaeota
Division or phylum: "Crenarchaeota"
Taxonomic ID (NCBI) 273057
Genome Sequence(s)
GenBank AE006641
EMBL AE006641.1
Gene Information
Gene NameSSO1171
NCBI Gene ID 27427475
GenBank Gene Sequence NZ_LT549890.1
Protein Information
Protein NameMaltose ABC transporter
UniProtKB/SwissProt ID Q97YY1
NCBI RefSeq WP_010923220.1
EMBL-CDSAAK41419.1
UniProtKB Sequence >tr|Q97YY1|Q97YY1_SULSO Maltose ABC transporter OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=SSO1171 PE=4 SV=1 MGRKGKKIDYKAISKTLVAVIIVVVIVIAIGGVYAFLSSQHSPAAPSSTTTSFTSTTSST TTSSVLNTSNPQALMQLVGISTPPSTPVTITVWNSYSTSENQAFNETLAQFEQAFPWIHV QVTYGVGVGTSQFETAAKAGQAPIVYRDTSDSGGALFAAGLVLNLSQYLPQSITSLYVPT AIKDWELNGSLYGLPDNVNYIVMFYNKKFVPYPPNTTEQLVQIAESVNKTYHVWGIAYGA GDEYGYRFAAWFAGFGGQIFTTNNGKIVPALNSTAMVNALNFWYNLTYNLKVNYLAPSTG AGGAEGQLFVANQTAIIFDGPWDLNAYLQALGPNLGAAPLPVVSQTGLRAAPFIGSTGFL VSSPQASGATPLQIKAALLFVLYFTNYQADLRLWEVAHDIPANLQAYNEALTQLKEGMLQ PTYLNQIMEGILEQAQYGQQFPNIPQMAYYWNSFHQYASEFFANKVNATQASQGMEQAFI QALVQNGLMSSLSPLPIIPQYMLLLISVILTPMVVVITPRKRW
Sequence length 523 AA
Subcellular LocationMembrane
Function Maltose ABC transporter
Glycosylation Status
Glycosylation Type N (Asn) linked
Experimentally Validated Glycosite(s) in Full Length ProteinN215 and N228
Glycosite(s) Annotated Protein Sequence >tr|Q97YY1|Q97YY1_SULSO Maltose ABC transporter OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=SSO1171 PE=4 SV=1 MGRKGKKIDYKAISKTLVAVIIVVVIVIAIGGVYAFLSSQHSPAAPSSTTTSFTSTTSST TTSSVLNTSNPQALMQLVGISTPPSTPVTITVWNSYSTSENQAFNETLAQFEQAFPWIHV QVTYGVGVGTSQFETAAKAGQAPIVYRDTSDSGGALFAAGLVLNLSQYLPQSITSLYVPT AIKDWELNGSLYGLPDNVNYIVMFYNKKFVPYPPN*(215)TTEQLVQIAESVN*(228)KTYHVWGIAYGA GDEYGYRFAAWFAGFGGQIFTTNNGKIVPALNSTAMVNALNFWYNLTYNLKVNYLAPSTG AGGAEGQLFVANQTAIIFDGPWDLNAYLQALGPNLGAAPLPVVSQTGLRAAPFIGSTGFL VSSPQASGATPLQIKAALLFVLYFTNYQADLRLWEVAHDIPANLQAYNEALTQLKEGMLQ PTYLNQIMEGILEQAQYGQQFPNIPQMAYYWNSFHQYASEFFANKVNATQASQGMEQAFI QALVQNGLMSSLSPLPIIPQYMLLLISVILTPMVVVITPRKRW
Sequence Around Glycosites (21 AA) YNKKFVPYPPNTTEQLVQIAE
EQLVQIAESVNKTYHVWGIAY
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionConcanavalin A lectin affinity chromatography
Glycan Information
Glycan Annotation Branched sulfated heptasaccharide, Hex4(GlcNAc)2 plus sulfoquinovose where Hex is D-mannose and D-glucose.
Literature
Additional CommentThe glycan structure is by far the most complex one known in archaea till now.
Year of Identification2013
Year of Identification Month Wise2013.6.1
Year of Validation 2013
ReferenceGianna Palmieri, Marco Balestrieri, Jasna Peter-Katalinić, Gottfried Pohlentz, Mosè Rossi, Immacolata Fiume, and Gabriella Pocsfalvi (2013) Surface-exposed glycoproteins of hyperthermophilic Sulfolobus solfataricus P2 show a common N-glycosylation profile. J. Proteome Res., 12, 2779−2790.
AuthorGianna Palmieri, Marco Balestrieri, Jasna Peter-Katalinić, Gottfried Pohlentz, Mosè Rossi, Immacolata Fiume, and Gabriella Pocsfalvi
Research GroupInstitute of Protein Biochemistry, National Research Council of Italy, Napoli, Italy.
Corresponding Author Gabriella Pocsfalvi
ContactInstitute of Protein Biochemistry, National Research Council of Italy, Napoli, Italy.