ProGP434 (Arabinose ABC transporter, arabinose bin

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP434 (Arabinose ABC transporter, arabinose bin
Validation Status Characterized
Organism Information
Organism NameSulfolobus solfataricus P2 (DSM 1617)
Domain Archaea
Classification Family: Sulfolobaceae
Order: Sulfolobales
Class: Thermoprotei or Crenarchaeota
Division or phylum: "Crenarchaeota"
Taxonomic ID (NCBI) 273057
Genome Information
GenBank AE006641
EMBL AE006641.1
Gene Information
Gene NameSSO3066
NCBI Gene ID 25403295
GenBank Gene Sequence NZ_CP011056.1
Protein Information
Protein NameArabinose ABC transporter, arabinose binding protein (AraS)
UniProtKB/SwissProt ID Q97UF5
NCBI RefSeq WP_009990876.1
EMBL-CDSAAK43166.1
UniProtKB Sequence >tr|Q97UF5|Q97UF5_SULSO Arabinose ABC transporter, arabinose binding protein OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=SSO3066 PE=4 SV=1 MSRRRLYKAISRTAIIIIVVVIIIAAIAGGLAAYYSSSKPPATSTSLTSTSSSLSVTTSS TTSTLSSITTTTSTASSYVVDFINPWGAEDPVGLKWIGGNFSIYYPGYSVQFTSLPGASG VEERYVVINDIEAGKLQGIFWAHGGPEVLSYVELLPSPHDLYNMTPLLAQEGLFQKGVTE ALMAISYNGTIFGSPTNVHRAEELYFNPQILKKYNLPIPTNLSLLIYDTQQLEAHGINPW AMSGAEGGYEQLHLWFAIFLSVAAQYYGAAGAAKLSNELMYGVLNLNNVTVQKIINETDN VFLQFVGQSSVIPSWQSQSIWSALALVIKGQTVFEAGGNWLAEYAAIWYNTTTYPATQPY LNWSNITLMAMPFPGTQGIYVIDMDSVAIPTVNNPQEQAAINFAKFWASYEGQKIWTYYK GVSIWANSTDYYSTPMQWYDYQSLLNTPAQNFTWAFADGTLFDDVFYFLIAQELNLQEQG SSYIPTFNAALFKAENMTFHEWQIAAKDGFGFVGQRGNPFGNYLPPWVNPSTYTYNSSYT PSFLLTPPHYLLPYLKKLGQQQYANKVNSVNYYAINGVNLLPFPLLIVLMIYLDQTRYKY VIKTFLNKINFFQIYFYLNF
Sequence length 620 AA
Glycosylation Status
Glycosylation Type N- (Asn) linked
Experimentally Validated Glycosite(s) in Full Length ProteinN535
Glycosite(s) Annotated Protein Sequence >tr|Q97UF5|Q97UF5_SULSO Arabinose ABC transporter, arabinose binding protein OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=SSO3066 PE=4 SV=1 MSRRRLYKAISRTAIIIIVVVIIIAAIAGGLAAYYSSSKPPATSTSLTSTSSSLSVTTSS TTSTLSSITTTTSTASSYVVDFINPWGAEDPVGLKWIGGNFSIYYPGYSVQFTSLPGASG VEERYVVINDIEAGKLQGIFWAHGGPEVLSYVELLPSPHDLYNMTPLLAQEGLFQKGVTE ALMAISYNGTIFGSPTNVHRAEELYFNPQILKKYNLPIPTNLSLLIYDTQQLEAHGINPW AMSGAEGGYEQLHLWFAIFLSVAAQYYGAAGAAKLSNELMYGVLNLNNVTVQKIINETDN VFLQFVGQSSVIPSWQSQSIWSALALVIKGQTVFEAGGNWLAEYAAIWYNTTTYPATQPY LNWSNITLMAMPFPGTQGIYVIDMDSVAIPTVNNPQEQAAINFAKFWASYEGQKIWTYYK GVSIWANSTDYYSTPMQWYDYQSLLNTPAQNFTWAFADGTLFDDVFYFLIAQELNLQEQG SSYIPTFNAALFKAENMTFHEWQIAAKDGFGFVGQRGNPFGNYLPPWVNPSTYTYN*(535)SSYT PSFLLTPPHYLLPYLKKLGQQQYANKVNSVNYYAINGVNLLPFPLLIVLMIYLDQTRYKY VIKTFLNKINFFQIYFYLNF
Sequence Around Glycosites (21 AA) PWVNPSTYTYNSSYTPSFLLT
Technique(s) used for Glycosylation DetectionConcanavalin A lectin affinity chromatography
Glycan Information
Glycan Annotation Branched sulfated heptasaccharide, Hex4(GlcNAc)2 plus sulfoquinovose where Hex is D-mannose and D-glucose.
Literature
Year of Identification2013
Year of Identification Month Wise2013.6.1
Year of Validation 2013