ProGP435

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP435
Validation Status Characterized
Organism Information
Organism NameSulfolobus solfataricus P2 (DSM 1617)
Domain Archaea
Classification Family: Sulfolobaceae
Order: Sulfolobales
Class: Thermoprotei or Crenarchaeota
Division or phylum: "Crenarchaeota"
Taxonomic ID (NCBI) 273057
Genome Sequence(s)
GenBank AE006641
EMBL AE006641.1
Gene Information
Gene NameSSO1175
GenBank Gene Sequence AE006641.1
Protein Information
Protein NameHypothetical protein
UniProtKB/SwissProt ID Q97YX7
NCBI RefSeq AAK41423.1
EMBL-CDSAAK41423.1
UniProtKB Sequence >tr|Q97YX7|Q97YX7_SULSO Uncharacterized protein OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=SSO1175 PE=4 SV=1 MYMKAKHLISLIVILTPLVTLLTSAVYTSGGITFYSPAYNGESYYTGQSITIDALLPQQF ATDAATINFFFPNSSLAVTIPVQINGSGGIYVPNAYAFPNVPGTWQITIEVAGGVAVGTI NVNVIQRTPLVTVHLGYGVVGQALPQTPTITLTFPNGTTITVPLQGTVNVPSGTSYQVEQ AITENNIRWATNYTSGTITPATTSITPTYYQQYLVTFNYTVQGGTGYSPPTVYYRSLGMN ETAKAPASVWVDANSAYIYSPELQSNVQGERWIAVNFTGIIKAPGEINEYYINQYLVTVQ SQIPVYAIVNGANETLNSTNWFTQGTTIKLENITKYVSSVERYVIANFSPSEVITVNQPT TIKVNTVTQYFINVNSPVQLKALINGANESLTAGWYNQGTSIKIENLTYYVGNGERLILG KVLPSLEIIVNGSYTISTTTITQYFVNVSSPIPVQVLINGSKTILNSSWINAGTSILVLN YTYNISPQERVIIVGISPSQSFTVNSPETLKLLTVTQYLVTINGVSKFYNSGSKIVLNAS VPFYETATFKGTYNVSPGATITVNQPITETLVESPNYLILGAIAAVIIIVVAVVVIILLR R
Sequence length 601 AA
Glycosylation Status
Glycosylation Type N- (Asn) linked
Experimentally Validated Glycosite(s) in Full Length ProteinN240, N280, N347, N406 and N538
Glycosite(s) Annotated Protein Sequence >tr|Q97YX7|Q97YX7_SULSO Uncharacterized protein OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=SSO1175 PE=4 SV=1 MYMKAKHLISLIVILTPLVTLLTSAVYTSGGITFYSPAYNGESYYTGQSITIDALLPQQF ATDAATINFFFPNSSLAVTIPVQINGSGGIYVPNAYAFPNVPGTWQITIEVAGGVAVGTI NVNVIQRTPLVTVHLGYGVVGQALPQTPTITLTFPNGTTITVPLQGTVNVPSGTSYQVEQ AITENNIRWATNYTSGTITPATTSITPTYYQQYLVTFNYTVQGGTGYSPPTVYYRSLGMN*(240) ETAKAPASVWVDANSAYIYSPELQSNVQGERWIAVN*(280)FTGIIKAPGEINEYYINQYLVTVQ SQIPVYAIVNGANETLNSTNWFTQGTTIKLENITKYVSSVERYVIAN*(347)FSPSEVITVNQPT TIKVNTVTQYFINVNSPVQLKALINGANESLTAGWYNQGTSIKIEN*(406)LTYYVGNGERLILG KVLPSLEIIVNGSYTISTTTITQYFVNVSSPIPVQVLINGSKTILNSSWINAGTSILVLN YTYNISPQERVIIVGISPSQSFTVNSPETLKLLTVTQYLVTINGVSKFYNSGSKIVLN*(538)AS VPFYETATFKGTYNVSPGATITVNQPITETLVESPNYLILGAIAAVIIIVVAVVVIILLR R
Sequence Around Glycosites (21 AA) PTVYYRSLGMNETAKAPASVW
NVQGERWIAVNFTGIIKAPGE
VSSVERYVIANFSPSEVITVN
YNQGTSIKIENLTYYVGNGER
FYNSGSKIVLNASVPFYETAT
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionConcanavalin A lectin affinity chromatography
Glycan Information
Glycan Annotation Branched sulfated heptasaccharide, Hex4(GlcNAc)2 plus sulfoquinovose where Hex is D-mannose and D-glucose.
Literature
Year of Identification2013
Year of Identification Month Wise2013.6.1
Year of Validation 2013
ReferenceGianna Palmieri, Marco Balestrieri, Jasna Peter-Katalinic?, Gottfried Pohlentz, Mose? Rossi, Immacolata Fiume, and Gabriella Pocsfalvi (2013) Surface-exposed glycoproteins of hyperthermophilic Sulfolobus solfataricus P2 show a common N-glycosylation profile. J. Proteome Res., 12, 2779?2790.
AuthorGianna Palmieri, Marco Balestrieri, Jasna Peter-Katalinic?, Gottfried Pohlentz, Mose? Rossi, Immacolata Fiume, and Gabriella Pocsfalvi
Research GroupInstitute of Protein Biochemistry, National Research Council of Italy, Napoli, Italy.
Corresponding Author Gabriella Pocsfalvi
ContactInstitute of Protein Biochemistry, National Research Council of Italy, Napoli, Italy.