ProGP438 (DnaK)

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP438 (DnaK)
Validation Status Characterized
Organism Information
Organism NameLactobacillus plantarum
Domain Bacteria
Classification Family: Lactobacillaceae
Order: Lactobacillales
Class: Bacilli (or Firmibacteria)
Division or phylum: "Firmicutes"
Taxonomic ID (NCBI) 220668
Genome Information
GenBank NC_004567.2.
EMBL AL935263
Gene Information
NCBI Gene ID 1064049.
GenBank Gene Sequence NC_004567.2.
Protein Information
Protein NameDnaK
UniProtKB/SwissProt ID Q88VM0
NCBI RefSeq WP_011101636.1.
EMBL-CDSCCC79273.1
UniProtKB Sequence >sp|Q88VM0|DNAK_LACPL Chaperone protein DnaK OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=dnaK PE=3 SV=1 MASNKIIGIDLGTTNSAVAVLEGNEPKIITTPEGGRTVPSVVAFKDGETQVGEVAKRQAI TNPNTVASIKRHMGEAGYKVSIEGKDYTPQQISAMILQYIKGFAEDYLGDTVEKAVVTVP AYFNDAQRQATKDAGKIAGLNIERIINEPTAAALAYGLDKTDKDEKILVYDLGGGTFDVS ILELGDGVFEVLSTNGDTHLGGDDFDQKIIDWLVDGFKADNGVDLSKDKMALQRLKDAAE KAKKDLSGVSEAQISLPFISAGASGPLHLETTLTRAKFNELTADLVEKTRIPVENALKDA DLSASDLDVVILNGGSTRIPAVQEAVEKWTGKESNHSINPDEAVALGAAVQGGVITGDVK DVVLLDVTPLSLGIETMGGVFTKLIDRNTTIPTSKSQVFSTAADNQPAVDIHVLQGERPM AADNKTLGRFQLTDIPAAPRGVPQIEVKFDIDKNGIVNVSAKDMGTNKEQKITIKSSSGL SDDEIDQMVKEAKENEEADKKRKEEVDLKNEVDQLIFTTDKTLKDLEGKVSEDEVKKAKD ARDALKKAQDDNNIDEMKAKKDDLNKIVQDLSVKLYQQAQEAQGAQGGADSNAAGNANSA KGSDDNTVDGDFEDLDKDKDKK
Sequence length 622 AA
Subcellular LocationIntracellular
Function Molecular chaperone
Glycosylation Status
Glycosylation Type O- (Ser) linked
Experimentally Validated Glycosite(s) in Full Length ProteinS592 and S599
Glycosite(s) Annotated Protein Sequence >sp|Q88VM0|DNAK_LACPL Chaperone protein DnaK OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=dnaK PE=3 SV=1 MASNKIIGIDLGTTNSAVAVLEGNEPKIITTPEGGRTVPSVVAFKDGETQVGEVAKRQAI TNPNTVASIKRHMGEAGYKVSIEGKDYTPQQISAMILQYIKGFAEDYLGDTVEKAVVTVP AYFNDAQRQATKDAGKIAGLNIERIINEPTAAALAYGLDKTDKDEKILVYDLGGGTFDVS ILELGDGVFEVLSTNGDTHLGGDDFDQKIIDWLVDGFKADNGVDLSKDKMALQRLKDAAE KAKKDLSGVSEAQISLPFISAGASGPLHLETTLTRAKFNELTADLVEKTRIPVENALKDA DLSASDLDVVILNGGSTRIPAVQEAVEKWTGKESNHSINPDEAVALGAAVQGGVITGDVK DVVLLDVTPLSLGIETMGGVFTKLIDRNTTIPTSKSQVFSTAADNQPAVDIHVLQGERPM AADNKTLGRFQLTDIPAAPRGVPQIEVKFDIDKNGIVNVSAKDMGTNKEQKITIKSSSGL SDDEIDQMVKEAKENEEADKKRKEEVDLKNEVDQLIFTTDKTLKDLEGKVSEDEVKKAKD ARDALKKAQDDNNIDEMKAKKDDLNKIVQDLSVKLYQQAQEAQGAQGGADS*(592)NAAGNANS*(599)A KGSDDNTVDGDFEDLDKDKDKK
Sequence Around Glycosites (21 AA) EAQGAQGGADSNAAGNANSAK
ADSNAAGNANSAKGSDDNTVD
ProGP Web Logo
Technique(s) used for Glycosylation DetectionGlycoprotein enrichment with agarose bound WGA
Technique(s) used for Glycosylated Residue(s) Detection LC-MS/MS analysis
Glycan Information
Glycan Annotation Monosaccharide (Double HexNAc, HexNAc)
Literature
Year of Identification2013
Year of Identification Month Wise2013.12.23
ReferenceFredriksen L, Moen A, Adzhubei AA, Mathiesen G, Eijsink VG, Egge-Jacobsen W. (2013) Lactobacillus plantarum WCFS1 O-linked protein glycosylation: an extended spectrum of target proteins and modification sites detected by mass spectrometry. Glycobiology, 23(12):1439-51. [PubMed: 24000282]
AuthorFredriksen L, Moen A, Adzhubei AA, Mathiesen G, Eijsink VG, Egge-Jacobsen W
Research GroupDepartment of Chemistry, Biotechnology and Food Science, Norwegian University of Life Sciences, 1432 Aas, Norway.
Corresponding Author Egge-Jacobsen W
ContactDepartment of Chemistry, Biotechnology and Food Science, Norwegian University of Life Sciences, 1432 Aas, Norway.