ProGP438

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP438
Validation Status Characterized
Organism Information
Organism NameSulfolobus solfataricus P2 (DSM 1617)
Domain Archaea
Classification Family: Sulfolobaceae
Order: Sulfolobales
Class: Thermoprotei or Crenarchaeota
Division or phylum: "Crenarchaeota"
Taxonomic ID (NCBI) 273057
Genome Sequence(s)
GenBank AE006641
EMBL AE006641.1
Gene Information
Gene NameSSO3066
NCBI Gene ID 25403295
GenBank Gene Sequence NZ_CP011056.1
Protein Information
Protein NameArabinose ABC transporter, arabinose binding protein (AraS)
UniProtKB/SwissProt ID Q97UF5
NCBI RefSeq WP_009990876.1
EMBL-CDSAAK43166.1
UniProtKB Sequence >tr|Q97UF5|Q97UF5_SULSO Arabinose ABC transporter, arabinose binding protein OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=SSO3066 PE=4 SV=1 MSRRRLYKAISRTAIIIIVVVIIIAAIAGGLAAYYSSSKPPATSTSLTSTSSSLSVTTSS TTSTLSSITTTTSTASSYVVDFINPWGAEDPVGLKWIGGNFSIYYPGYSVQFTSLPGASG VEERYVVINDIEAGKLQGIFWAHGGPEVLSYVELLPSPHDLYNMTPLLAQEGLFQKGVTE ALMAISYNGTIFGSPTNVHRAEELYFNPQILKKYNLPIPTNLSLLIYDTQQLEAHGINPW AMSGAEGGYEQLHLWFAIFLSVAAQYYGAAGAAKLSNELMYGVLNLNNVTVQKIINETDN VFLQFVGQSSVIPSWQSQSIWSALALVIKGQTVFEAGGNWLAEYAAIWYNTTTYPATQPY LNWSNITLMAMPFPGTQGIYVIDMDSVAIPTVNNPQEQAAINFAKFWASYEGQKIWTYYK GVSIWANSTDYYSTPMQWYDYQSLLNTPAQNFTWAFADGTLFDDVFYFLIAQELNLQEQG SSYIPTFNAALFKAENMTFHEWQIAAKDGFGFVGQRGNPFGNYLPPWVNPSTYTYNSSYT PSFLLTPPHYLLPYLKKLGQQQYANKVNSVNYYAINGVNLLPFPLLIVLMIYLDQTRYKY VIKTFLNKINFFQIYFYLNF
Sequence length 620 AA
Glycosylation Status
Glycosylation Type N- (Asn) linked
Experimentally Validated Glycosite(s) in Full Length ProteinN535
Glycosite(s) Annotated Protein Sequence >tr|Q97UF5|Q97UF5_SULSO Arabinose ABC transporter, arabinose binding protein OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=SSO3066 PE=4 SV=1 MSRRRLYKAISRTAIIIIVVVIIIAAIAGGLAAYYSSSKPPATSTSLTSTSSSLSVTTSS TTSTLSSITTTTSTASSYVVDFINPWGAEDPVGLKWIGGNFSIYYPGYSVQFTSLPGASG VEERYVVINDIEAGKLQGIFWAHGGPEVLSYVELLPSPHDLYNMTPLLAQEGLFQKGVTE ALMAISYNGTIFGSPTNVHRAEELYFNPQILKKYNLPIPTNLSLLIYDTQQLEAHGINPW AMSGAEGGYEQLHLWFAIFLSVAAQYYGAAGAAKLSNELMYGVLNLNNVTVQKIINETDN VFLQFVGQSSVIPSWQSQSIWSALALVIKGQTVFEAGGNWLAEYAAIWYNTTTYPATQPY LNWSNITLMAMPFPGTQGIYVIDMDSVAIPTVNNPQEQAAINFAKFWASYEGQKIWTYYK GVSIWANSTDYYSTPMQWYDYQSLLNTPAQNFTWAFADGTLFDDVFYFLIAQELNLQEQG SSYIPTFNAALFKAENMTFHEWQIAAKDGFGFVGQRGNPFGNYLPPWVNPSTYTYN*(535)SSYT PSFLLTPPHYLLPYLKKLGQQQYANKVNSVNYYAINGVNLLPFPLLIVLMIYLDQTRYKY VIKTFLNKINFFQIYFYLNF
Sequence Around Glycosites (21 AA) PWVNPSTYTYNSSYTPSFLLT
Technique(s) used for Glycosylation DetectionConcanavalin A lectin affinity chromatography
Glycan Information
Glycan Annotation Branched sulfated heptasaccharide, Hex4(GlcNAc)2 plus sulfoquinovose where Hex is D-mannose and D-glucose.
Literature
Year of Identification2013
Year of Identification Month Wise2013.6.1
Year of Validation 2013
ReferenceGianna Palmieri, Marco Balestrieri, Jasna Peter-Katalinic?, Gottfried Pohlentz, Mose? Rossi, Immacolata Fiume, and Gabriella Pocsfalvi (2013) Surface-exposed glycoproteins of hyperthermophilic Sulfolobus solfataricus P2 show a common N-glycosylation profile. J. Proteome Res., 12, 2779?2790.
AuthorGianna Palmieri, Marco Balestrieri, Jasna Peter-Katalinic?, Gottfried Pohlentz, Mose? Rossi, Immacolata Fiume, and Gabriella Pocsfalvi
Research GroupInstitute of Protein Biochemistry, National Research Council of Italy, Napoli, Italy.
Corresponding Author Gabriella Pocsfalvi
ContactInstitute of Protein Biochemistry, National Research Council of Italy, Napoli, Italy.