ProGP439

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP439
Validation Status Characterized
Organism Information
Organism NameMycobacterium smegmatis mc2-155
Domain Bacteria
Classification Family: Mycobacteriaceae
Suborder: Corynebacterineae
Order: Actinomycetales
Subclass: Actinobacteridae
Class: Actinobacteria
Division or phylum: "Actinobacteria"
Taxonomic ID (NCBI) 246196
Genome Sequence(s)
GenBank CP000480.1
EMBL CP000480.1
Gene Information
Gene NamefasC (Msmeg_5196)
NCBI Gene ID 4534221
GenBank Gene Sequence NC_008596.1
Protein Information
Protein NameFasC (fasciclin domain protein)
UniProtKB/SwissProt ID A0R2Q4
NCBI RefSeq YP_889442.1
EMBL-CDSAFP41505.1
UniProtKB Sequence >tr|A0R2Q4|A0R2Q4_MYCS2 Beta-Ig-H3/fasciclin OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=MSMEG_5196 PE=4 SV=1 MHTRTKTLGAAAAIAAIATSLPLAVTAYAEPETTTEAEPTVEIPDPQGPGCDDFKKAVPS WKALNDVPVSQALAAIPEISTFNAAVSGGLNPAVNIDPVLDNGPYVVFAPTNEAFAKLAP GQLDAIAADPAALTSLDYYHAFLGLLGNDDVKGQRPTQQGAEIKVTGKGGDIEVNDTAKL VCGAIHAQNARIYLIDTVLDPNNPPEALTPTVSGTSTTPTTTTETTEPAPAEAPESAETP EAMPAADAPIG
Sequence length 251 AA
Function Beta-Ig-H3/fasciclin
Glycosylation Status
Glycosylation Type O (Ser/Thr) linked
Experimentally Validated Glycosite(s) in Full Length ProteinT33 and T34
Glycosite(s) Annotated Protein Sequence >tr|A0R2Q4|A0R2Q4_MYCS2 Beta-Ig-H3/fasciclin OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=MSMEG_5196 PE=4 SV=1 MHTRTKTLGAAAAIAAIATSLPLAVTAYAEPETT*(33)T*(34)EAEPTVEIPDPQGPGCDDFKKAVPS WKALNDVPVSQALAAIPEISTFNAAVSGGLNPAVNIDPVLDNGPYVVFAPTNEAFAKLAP GQLDAIAADPAALTSLDYYHAFLGLLGNDDVKGQRPTQQGAEIKVTGKGGDIEVNDTAKL VCGAIHAQNARIYLIDTVLDPNNPPEALTPTVSGTSTTPTTTTETTEPAPAEAPESAETP EAMPAADAPIG
Sequence Around Glycosites (21 AA) LAVTAYAEPETTTEAEPTVEI
AVTAYAEPETTTEAEPTVEIP
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionAberrant migration on SDS-PAGE
Technique(s) used for Glycosylated Residue(s) Detection Electron transfer dissociation (ETD) MS/MS analysis
Glycan Information
Glycan Annotation Glycosylated by α-mannose residues exclusively.
Technique(s) used for Glycan Identification Carbohydrate content capillary zone electrophoresis analysis and α-exo-mannosidase susceptibility study
Protein Glycosylation linked (PGL) gene(s)
OST ProGT IDProGT62,ProGT63
Characterized Accessory Gene(s)Msmeg_5447
Literature
Additional CommentFasC is the first ever mannoprotein characterized in M. smegmatis
Year of Identification2013
Year of Identification Month Wise2013.6.1
Year of Validation 2013
ReferenceLiu CF, Tonini L, Malaga W, Beau M, Stella A, Bouyssié D, Jackson MC, Nigou J, Puzo G, Guilhot C, Burlet-Schiltz O, Rivière M. (2013) Bacterial protein-O-mannosylating enzyme is crucial for virulence of Mycobacterium tuberculosis. Proc Natl Acad Sci U S A., 110(16):6560-5.
AuthorLiu CF, Tonini L, Malaga W, Beau M, Stella A, Bouyssié D, Jackson MC, Nigou J, Puzo G, Guilhot C, Burlet-Schiltz O, Rivière M
Research GroupCentre National de la Recherche Scientifique, Institut de Pharmacologie et de Biologie Structurale, F-31077 Toulouse, France
Corresponding Author Rivière M
ContactCentre National de la Recherche Scientifique, Institut de Pharmacologie et de Biologie Structurale, F-31077 Toulouse, France