ProGP440

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP440
Validation Status Characterized
Organism Information
Organism NameLactobacillus plantarum
Domain Bacteria
Classification Family: Lactobacillaceae
Order: Lactobacillales
Class: Bacilli (or Firmibacteria)
Division or phylum: "Firmicutes"
Taxonomic ID (NCBI) 220668
Genome Sequence(s)
GenBank NC_004567.2. 
EMBL AL935263
Gene Information
Gene Nameacm2
GenBank Gene Sequence NC_004567.2. 
Protein Information
Protein NameAcm2
UniProtKB/SwissProt ID F9URD9
NCBI RefSeq WP_011101863.1.
EMBL-CDSCCC79778.1.
UniProtKB Sequence >tr|F9URD9|F9URD9_LACPL Cell wall hydrolase/muramidase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=acm2 PE=4 SV=1 MKIGMTKKVVTSLLLSTALLPMLSGKADTASANQKPAAATKGNSAASAASQQVTLSAGSQ TETTAAGATDQSVASDGAKTDDQAESTSTTTATTSATSRVTVRAASQAAKADSTGPQSQS SASEAAKDNAATSATADSTTSAVDQLDKTAKASAATSQASHSTTNETAKASAAASQDSHV TTDQSSVTVTSEVAKSAASSAAPKQATEQAVAAKISPKIETAVAADAVQSSAMMARSTRA MTSQEIFLSQIKAGAISGWNKYQVLPSVTAAQAILESGWGQSQLATQGNNLFGIKGSYQG QSIYFPTQEWNGSQYITIQDAFRKYPNWSASVEDHGAFLVVNPRYSNLIGVTDYRRVASL LQQDGYATAPTYASSLISIIEYNKLHEWDQEALSGQASGGNDNNQVQPDQDVTPTSGTHK FTKTTTIHNAPDATSAVVGTYNAGETVNYNGKLTVGNATWLRYQSYSGVSRYVMISQTTT NDNNNQATVTPASGSYKFTAKTNIRSAASKTAQVVGTYNAGETVYYNGKITTGGTTWLRY LSYSGAQHYVAMSGDEVGSVAKPDVVATSGSYRFTKTTAIKSSPATSATTVGSYNAGDTV YYNGKVTTNGQTWLRYMSYSGAQHYVQISGESTSTNVDKPQVTPQSGSYRFTQTTAIKNT PAGNAPSVGTYSAGDTVYYNAKVTANGQTWLRYLSYSGAQHYVAISGNAATGNTTSKPVT NSQGAFRFVTTTNIRTAPSTRASVVGEYNPGETVYYNGTVQAEGYTWLRYLSRSGATHYV AKLEG
Sequence length 785 AA
Subcellular LocationExtracellular
Function Acm2 is the major autolysin of Lactobacillus plantarum.
Glycosylation Status
Glycosylation Type O (Ser) linked
Experimentally Validated Glycosite(s) in Full Length ProteinS86 and S95
Glycosite(s) Annotated Protein Sequence >tr|F9URD9|F9URD9_LACPL Cell wall hydrolase/muramidase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=acm2 PE=4 SV=1 MKIGMTKKVVTSLLLSTALLPMLSGKADTASANQKPAAATKGNSAASAASQQVTLSAGSQ TETTAAGATDQSVASDGAKTDDQAES*(83)TSTTTATTSATS*(95)RVTVRAASQAAKADSTGPQSQS SASEAAKDNAATSATADSTTSAVDQLDKTAKASAATSQASHSTTNETAKASAAASQDSHV TTDQSSVTVTSEVAKSAASSAAPKQATEQAVAAKISPKIETAVAADAVQSSAMMARSTRA MTSQEIFLSQIKAGAISGWNKYQVLPSVTAAQAILESGWGQSQLATQGNNLFGIKGSYQG QSIYFPTQEWNGSQYITIQDAFRKYPNWSASVEDHGAFLVVNPRYSNLIGVTDYRRVASL LQQDGYATAPTYASSLISIIEYNKLHEWDQEALSGQASGGNDNNQVQPDQDVTPTSGTHK FTKTTTIHNAPDATSAVVGTYNAGETVNYNGKLTVGNATWLRYQSYSGVSRYVMISQTTT NDNNNQATVTPASGSYKFTAKTNIRSAASKTAQVVGTYNAGETVYYNGKITTGGTTWLRY LSYSGAQHYVAMSGDEVGSVAKPDVVATSGSYRFTKTTAIKSSPATSATTVGSYNAGDTV YYNGKVTTNGQTWLRYMSYSGAQHYVQISGESTSTNVDKPQVTPQSGSYRFTQTTAIKNT PAGNAPSVGTYSAGDTVYYNAKVTANGQTWLRYLSYSGAQHYVAISGNAATGNTTSKPVT NSQGAFRFVTTTNIRTAPSTRASVVGEYNPGETVYYNGTVQAEGYTWLRYLSRSGATHYV AKLEG
Sequence Around Glycosites (21 AA) DGAKTDDQAESTSTTTATTSA
ESTSTTTATTSATSRVTVRAA
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionMigration on SDS-PAGE , a lectin blot using GlcNAc-specific succinylated wheat germ agglutinin (sWGA), Glycoprotein enrichment with agarose bound WGA
Technique(s) used for Glycosylated Residue(s) Detection MALDI-TOF/TOF, LC-MS/MS analysis
Glycan Information
Glycan Annotation Monosaccharide (Double HexNAc, HexNAc)
Protein Glycosylation linked (PGL) gene(s)
OST ProGT IDProGT70,ProGT71
Literature
Year of Identification2013
Year of Identification Month Wise2013.8.2
ReferenceRolain T, Bernard E, Beaussart A, Degand H, Courtin P, Egge-Jacobsen W, Bron PA, Morsomme P, Kleerebezem M, Chapot-Chartier MP, Dufrêne YF, Hols P. (2013) O-glycosylation as a novel control mechanism of peptidoglycan hydrolase activity. J Biol Chem. 2013 Aug 2;288(31):22233-47. doi: 10.1074/jbc.M113.470716. Epub 2013 Jun 12.
AuthorRolain T, Bernard E, Beaussart A, Degand H, Courtin P, Egge-Jacobsen W, Bron PA, Morsomme P, Kleerebezem M, Chapot-Chartier MP, Dufrêne YF, Hols P
Research GroupInstitut des Sciences de la Vie, Université catholique de Louvain, B-1348 Louvain-la-Neuve, Belgium
Corresponding Author Hols P
ContactInstitut des Sciences de la Vie, Université catholique de Louvain, B-1348 Louvain-la-Neuve, Belgium
ReferenceFredriksen L1, Moen A, Adzhubei AA, Mathiesen G, Eijsink VG, Egge-Jacobsen W. (2013) Lactobacillus plantarum WCFS1 O-linked protein glycosylation: an extended spectrum of target proteins and modification sites detected by mass spectrometry. Glycobiology. 2013 Dec;23(12):1439-51. doi: 10.1093/glycob/cwt071. Epub 2013 Sep 1.
AuthorFredriksen L1, Moen A, Adzhubei AA, Mathiesen G, Eijsink VG, Egge-Jacobsen W
Research GroupDepartment of Chemistry, Biotechnology and Food Science, Norwegian University of Life Sciences, 1432 Aas, Norway.
Corresponding Author Egge-Jacobsen W
ContactDepartment of Chemistry, Biotechnology and Food Science, Norwegian University of Life Sciences, 1432 Aas, Norway.