ProGP448

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP448
Validation Status Uncharacterized
Organism Information
Organism NameLactobacillus plantarum
Domain Bacteria
Classification Family: Lactobacillaceae
Order: Lactobacillales
Class: Bacilli (or Firmibacteria)
Division or phylum: "Firmicutes"
Taxonomic ID (NCBI) 1590
Genome Sequence(s)
GenBank AB474371
EMBL AB474371
Protein Information
Protein NameLp_ 2793
UniProtKB/SwissProt ID F9URQ9
NCBI RefSeq WP_011101917.1
EMBL-CDSCCC79898.2
UniProtKB Sequence >tr|F9URQ9|F9URQ9_LACPL Uncharacterized protein OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=lp_2793 PE=4 SV=1 MVLSRKNKKEGLGRRLWNSITEPIPDDDSTEQDNEQIPLAYDLKDSAASKADEAEAKSTV NIPRSTANNSAEKQPVDAVIEPEKVAKKARHSGDDRQAAKQSTAPVKHGATSAVKQKGSA GSQSSAKAESAQITKKSAATKPASTASQAAPKTASAVSSQAVSDQRFKHAASTTASAAQS APARAAKEASQATSTAVSDQKRVAKTTASTKVHQSAATSEVPMTRMARRASQEAASQAKT HSQQSSASTSSAAAAASAVAQSTAPKSTAPKSATSKAAVSQATATTAKDPQATAAKQPKV ERRIPADHIPPVARKQQPRIAVKGTEQADDDTQPELPLSREELYGDQQPNGGKQPNKPTM SRVARHEEQRVPHDDQPDDDRDFSELETDEKNPHLKKPARRYNWKLMLAGVAILVVAAGG AFFMWNHGQATQAAARTNAEKIVDQVYTSSAQRDLRASASSSTLTKLQNNIDNMKDSSEK TRLQKQHDTAAKMLTVRTSYQDLRNAKGLLKTDVTMDTITKGQQRLTTAGLTTSKPYFAK KYDKLFTTTGKTVKKVVSYDADFQKLYNKKNKLKASTPSTTVDKVLANLKAYRKKSQLAA NDYQKLITDRKKLAKANNASSSASSSSTYSYSEPESSSSSSYSTYSESSDNSSSASTHSY SNDTDTSSATSSSSTPSYSYSANTDSSSTTNYGDTSSTTTGGTASSTDGYSTATGNN
Sequence length 717 AA
Subcellular LocationIntracellular
Function Hypothetical protein
Glycosylation Status
Glycosylation Type O- (Ser/Thr) linked
Experimentally Validated Glycosite(s ) in Mature Protein>tr|O06213|O06213_MYCTU Membrane protein OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2164c PE=1 SV=1 MRAKREAPKSRSSDRRRRADSPAAATRRTTTNSAPSRRIRSRAGKTSAPGRQARVSRPGP QTSPMLSPFDRPAP
Technique(s) used for Glycosylation DetectionGlycoprotein enrichment with agarose bound WGA, LC-MS/MS analysis
Glycan Information
Glycan Annotation Monosaccharide (Double HexNAc, HexNAc)
Literature
Year of Identification2013
Year of Identification Month Wise2013.12.23
ReferenceFredriksen L, Moen A, Adzhubei AA, Mathiesen G, Eijsink VG, Egge-Jacobsen W. (2013) Lactobacillus plantarum WCFS1 O-linked protein glycosylation: an extended spectrum of target proteins and modification sites detected by mass spectrometry. Glycobiology. 2013 Dec;23(12):1439-51. doi: 10.1093/glycob/cwt071. Epub 2013 Sep 1.
AuthorFredriksen L, Moen A, Adzhubei AA, Mathiesen G, Eijsink VG, Egge-Jacobsen W
Research GroupDepartment of Chemistry, Biotechnology and Food Science, Norwegian University of Life Sciences, 1432 Aas, Norway.
Corresponding Author Egge-Jacobsen W
ContactDepartment of Chemistry, Biotechnology and Food Science, Norwegian University of Life Sciences, 1432 Aas, Norway.