ProGP455 (35kDa protein)

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP455 (35kDa protein)
Validation Status Characterized
Organism Information
Organism NameMycobacterium tuberculosis H37Rv
Domain Bacteria
Classification Family: Mycobacteriaceae
Suborder: Corynebacterineae
Order: Actinomycetales
Subclass: Actinobacteridae
Class: Actinobacteria
Division or phylum: "Actinobacteria"
Taxonomic ID (NCBI) 83332
Genome Information
GenBank NC_000962.3
EMBL CP009480
Organism Additional Information It is the causative agent of human tuberculosis. The pathogenesis is influenced by its lipoglycans and glycolipids (having a wide range of immunomodulatory activities), and a variety of its virulence factors and antigens.
Gene Information
Gene NameRv2744c
NCBI Gene ID 888304
GenBank Gene Sequence NC_000962.3
Protein Information
Protein Name35kDa protein
UniProtKB/SwissProt ID P9WHP5
NCBI RefSeq YP_177903
EMBL-CDSCCP45543.1.
UniProtKB Sequence >sp|P9WHP5|35KD_MYCTU 35 kDa protein OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2744c PE=1 SV=1 MANPFVKAWKYLMALFSSKIDEHADPKVQIQQAIEEAQRTHQALTQQAAQVIGNQRQLEM RLNRQLADIEKLQVNVRQALTLADQATAAGDAAKATEYNNAAEAFAAQLVTAEQSVEDLK TLHDQALSAAAQAKKAVERNAMVLQQKIAERTKLLSQLEQAKMQEQVSASLRSMSELAAP GNTPSLDEVRDKIERRYANAIGSAELAESSVQGRMLEVEQAGIQMAGHSRLEQIRASMRG EALPAGGTTATPRPATETSGGAIAEQPYGQ
Sequence length 270 AA
Subcellular LocationCytoplasm
Glycosylation Status
Glycosylation Type O- (Thr) linked
Experimentally Validated Glycosite(s) in Full Length ProteinT248, T249 or T251
Glycosite(s) Annotated Protein Sequence >sp|P9WHP5|35KD_MYCTU 35 kDa protein OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2744c PE=1 SV=1 MANPFVKAWKYLMALFSSKIDEHADPKVQIQQAIEEAQRTHQALTQQAAQVIGNQRQLEM RLNRQLADIEKLQVNVRQALTLADQATAAGDAAKATEYNNAAEAFAAQLVTAEQSVEDLK TLHDQALSAAAQAKKAVERNAMVLQQKIAERTKLLSQLEQAKMQEQVSASLRSMSELAAP GNTPSLDEVRDKIERRYANAIGSAELAESSVQGRMLEVEQAGIQMAGHSRLEQIRASMRG EALPAGGT*(248)T*(249)AT*(251)PRPATETSGGAIAEQPYGQ
Sequence Around Glycosites (21 AA) MRGEALPAGGTTATPRPATET
RGEALPAGGTTATPRPATETS
EALPAGGTTATPRPATETSGG
Average Amino Acid Composition around Glycosite(s)_GEALPAGGT(he)TATPR__GEALPAGGTT(he)ATPR_
ProGP Web Logo
Technique(s) used for Glycosylation DetectionLC-MS
Technique(s) used for Glycosylated Residue(s) Detection ETD
Glycan Information
Glycan Annotation Hex
Literature
Year of Identification2014
Year of Identification Month Wise2014.1.31
ReferenceSmith GT, Sweredoski MJ, Hess S (2014) O-linked glycosylation sites profiling in Mycobacterium tuberculosis culture filtrate proteins.J Proteomics, 97:296-306. [PubMed: 23702328]
AuthorSmith, Geoffrey T., Michael J. Sweredoski, and Sonja Hess.
Research GroupProteome Exploration Laboratory, Beckman Institute, California Institute of Technology, Pasadena, CA, USA
Corresponding Author Sonja Hess.
ContactProteome Exploration Laboratory, Beckman Institute, California Institute of Technology, Pasadena, CA, USA